DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and PYCARD

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_037390.2 Gene:PYCARD / 29108 HGNCID:16608 Length:195 Species:Homo sapiens


Alignment Length:114 Identity:25/114 - (21%)
Similarity:44/114 - (38%) Gaps:20/114 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQPPELEIGMPKRH--REHIRKNLNILVEWTNYERLAMECVQQGILTVQMLRNTQDLNGKPFNMD 63
            :|.|......|..|  .:|   ...::...||.|.| ::.:...:||.:..   |.:..:|.|..
Human   100 IQAPPQSAAKPGLHFIDQH---RAALIARVTNVEWL-LDALYGKVLTDEQY---QAVRAEPTNPS 157

  Fly    64 EKDVRVEQHRRLLLKITQRGPTAYNLLINALRNINCLDAAVLLESVDES 112
            :.       |:|.........|..:||:.|||.    ..:.|:|.::.|
Human   158 KM-------RKLFSFTPAWNWTCKDLLLQALRE----SQSYLVEDLERS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018 17/87 (20%)
CASc 186..443 CDD:237997
PYCARDNP_037390.2 Pyrin_ASC-like 5..86 CDD:260033
CARD_ASC_NALP1 113..193 CDD:260039 21/97 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152738
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.