DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and Pycard

DIOPT Version :10

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_758825.2 Gene:Pycard / 282817 RGDID:628637 Length:193 Species:Rattus norvegicus


Alignment Length:34 Identity:11/34 - (32%)
Similarity:16/34 - (47%) Gaps:2/34 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 TAQEEKWPDTQTEGIPSPSTNVPSLADTLVCYAN 373
            ||:.|.:.|...:.:.:..|.|..|.|.|  |.|
  Rat   106 TARTEHFVDQHRQALIARVTEVDGLLDAL--YGN 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 11/34 (32%)
PycardNP_758825.2 Pyrin_ASC-like 5..87 CDD:260033
CARD_ASC_NALP1 111..191 CDD:260039 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.