DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and Casp3

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_037054.1 Gene:Casp3 / 25402 RGDID:2275 Length:277 Species:Rattus norvegicus


Alignment Length:312 Identity:77/312 - (24%)
Similarity:126/312 - (40%) Gaps:77/312 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 VDGPEVK--KSKKIHGGDSAILGTYKMQSRFNRGVLLMVNIMDYPD-------QNRR-------- 212
            ||...:.  ::|.|||..|...|.| :.|.:.         ||||:       .|:.        
  Rat     8 VDSKSINNFETKTIHGSKSMDSGIY-LDSSYK---------MDYPEMGLCIIINNKNFHKSTGMS 62

  Fly   213 -RIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQFFKLLTMVTSSSYVQNTECFVMVLMTHGNSVE 276
             |.|.:.|:.:|...|..|.:.:....::.:::..:|:..|:...:.:.:. ||.|:::||:   
  Rat    63 ARNGTDVDAANLRETFMALKYEVRNKNDLTREEIMELMDSVSKEDHSKRSS-FVCVILSHGD--- 123

  Fly   277 GKEKVEFCDGSVVDMQKIKDHFQTAKCPYLVNKPKVLMFPFCRGDEYDLGHPKNQGNLMEPVYTA 341
              |.|.|.....||::|:...|:...|..|..|||:.:...|||.|.|.|...:.|.  :.....
  Rat   124 --EGVIFGTNGPVDLKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGT--DDDMAC 184

  Fly   342 QEEKWPDTQTEGIPSPSTNVPSLADTLVCYANTPGYVTHRDLDTGSWYIQKFCQVMADHAHDTDL 406
            |:                 :|..||.|..|:..|||.:.|:...|||:||..|.::..:||..:.
  Rat   185 QK-----------------IPVEADFLYAYSTAPGYYSWRNSRDGSWFIQSLCAMLKLYAHKLEF 232

  Fly   407 EDILKKTSEAVGNK----------RTKKG-----SMQTGAYDNLGFNKKLYF 443
            ..||.:.:..|..:          ..||.     ||.|         |:|||
  Rat   233 MHILTRVNRKVATEFESFSLDATFHAKKQIPCIVSMLT---------KELYF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 67/287 (23%)
Casp3NP_037054.1 CASc 37..277 CDD:214521 67/282 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.