DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and Casp1

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_036894.3 Gene:Casp1 / 25166 RGDID:2274 Length:402 Species:Rattus norvegicus


Alignment Length:419 Identity:98/419 - (23%)
Similarity:174/419 - (41%) Gaps:74/419 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LNGKPFNMDEKD-------VRVEQHRRLLLKITQRGPTAYNLLINALRNINCLDAAVL-LES--- 108
            |..:..|.:|.|       ..:|:.|.|...:|::||.|..:.|..:.|.:|..|.:| |:|   
  Rat    30 LEKRVLNQEEMDTIKLANITVMEKARDLCDHVTKKGPRASQMFITYICNEDCYLAEILELQSGPS 94

  Fly   109 ------VDESDSRPPFISLNERRTSRKSADIVDTPSPEASEGPCVSKLRNEPLGALTPYVGVVDG 167
                  .::|....||.|..:.:.:::....   |.|..|...|..::..               
  Rat    95 AETVFVTEDSKGGHPFSSETKEKLNKEGGAF---PGPSGSLKFCPLEIAQ--------------- 141

  Fly   168 PEVKKSKKIHGGDSAILGTYKMQSRFNRGVLLMVNIMDYPDQNRRRIGAEKDSKSLIHLFQELNF 232
               |..|:.|   |.|....|..:| .|..|::.| .|:...: ||:||:.|.:.:..|.|:|.:
  Rat   142 ---KLWKENH---SEIYPIMKTPTR-TRLALIICN-TDFQHLS-RRVGADVDLREMKLLLQDLGY 197

  Fly   233 TIFPYGNVNQDQFFKLLTMVTSSSYVQNTECFVMVLMTHGNSVEGKEKVEFCDGSVVDMQKIKDH 297
            |:....|:...:..|.|....:....:.::...:|.|:||.. ||...:.: ...|.|:.|:...
  Rat   198 TVKVKENLTALEMTKELKEFAACPEHKTSDSTFLVFMSHGLQ-EGICGITY-SNEVADILKVDTI 260

  Fly   298 FQ---TAKCPYLVNKPKVLMFPFCRGDEY-------DLGHPKNQGNLMEPVYTAQEEKWPDTQTE 352
            ||   |.|||.|.:||||::...|||::.       .:|: ..:|.|.:.::          :.:
  Rat   261 FQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVGN-SEEGFLTDAIF----------EDD 314

  Fly   353 GIPSPSTNVPSLADTLVCYANTPGYVTHRDLDTGSWYIQKFCQVMADHAHDTDLEDILKKTSEAV 417
            ||......    .|.:...::||..|:.|....||.:|:...:.|.::|...|||||.:|...:.
  Rat   315 GIKKAHIE----KDFIAFCSSTPDNVSWRHPVQGSLFIESLIKHMKEYAWSCDLEDIFRKVRFSF 375

  Fly   418 GNKRTKKGSMQTGAYDNLGFNKKLYFNPG 446
            ....::   :|....:.:...|:.|..||
  Rat   376 EQPDSR---LQMPTTERVTLTKRFYLFPG 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018 16/58 (28%)
CASc 186..443 CDD:237997 64/266 (24%)
Casp1NP_036894.3 CARD_CASP1-like 6..87 CDD:260036 15/56 (27%)
CASc 152..400 CDD:214521 65/270 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346264
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.