DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and ZK795.2

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_502403.2 Gene:ZK795.2 / 178206 WormBaseID:WBGene00014082 Length:292 Species:Caenorhabditis elegans


Alignment Length:125 Identity:35/125 - (28%)
Similarity:51/125 - (40%) Gaps:24/125 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PFNMDEKDVRVEQHRRLLLK--ITQRGPTAYNLLI----NALRNINCLDAAVLLESVDESDSRPP 117
            |....|...|.|:..|.:||  |...|....:||:    .:|...|  :|....|...|...:  
 Worm   171 PDEYPETAEREEKRNRRILKAIIALMGLALCSLLVIMFMGSLSRYN--EAKKQKELEQEKQKK-- 231

  Fly   118 FISLNERRTSRKSADIVDTPSPEASEGPCVSKLRNEP--LGALTPYVGVVDGPEVKKSKK 175
                :|::|:.||...|   .|||||....|:...:|  .|...|   ::|..  |||:|
 Worm   232 ----HEQKTAEKSEKAV---KPEASEKSVKSEKSEKPQKAGEKEP---LIDSS--KKSEK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018 14/52 (27%)
CASc 186..443 CDD:237997
ZK795.2NP_502403.2 DUF1510 180..>263 CDD:284770 26/93 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.