DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and ZK795.2

DIOPT Version :10

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_502403.2 Gene:ZK795.2 / 178206 WormBaseID:WBGene00014082 Length:292 Species:Caenorhabditis elegans


Alignment Length:125 Identity:35/125 - (28%)
Similarity:51/125 - (40%) Gaps:24/125 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PFNMDEKDVRVEQHRRLLLK--ITQRGPTAYNLLI----NALRNINCLDAAVLLESVDESDSRPP 117
            |....|...|.|:..|.:||  |...|....:||:    .:|...|  :|....|...|...:  
 Worm   171 PDEYPETAEREEKRNRRILKAIIALMGLALCSLLVIMFMGSLSRYN--EAKKQKELEQEKQKK-- 231

  Fly   118 FISLNERRTSRKSADIVDTPSPEASEGPCVSKLRNEP--LGALTPYVGVVDGPEVKKSKK 175
                :|::|:.||...|   .|||||....|:...:|  .|...|   ::|..  |||:|
 Worm   232 ----HEQKTAEKSEKAV---KPEASEKSVKSEKSEKPQKAGEKEP---LIDSS--KKSEK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018 14/52 (27%)
CASc 186..443 CDD:237997
ZK795.2NP_502403.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.