DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and Casp12

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_569106.1 Gene:Casp12 / 156117 RGDID:621758 Length:420 Species:Rattus norvegicus


Alignment Length:345 Identity:78/345 - (22%)
Similarity:129/345 - (37%) Gaps:61/345 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 TPSPEASEGPCVSKLRNEPLGALTPYVGV-------------VDGPEVKKSKKIHGGD------- 180
            ||| .|||..  .|:.:|.:..   .|||             :...||:.|.|:...|       
  Rat   102 TPS-SASESR--GKVEDEEMEV---NVGVAHASHLMLTVPQGIQSTEVQDSLKLCSRDWFCTMKT 160

  Fly   181 ---SAILGTYKMQSRFNRGVLLMVNIMDYPDQNRRRIGAEKDSKSLIHLFQELNFTIFPYGNVNQ 242
               ..|....:.:.|....:::.....||...   |..||.|..::..|.|.|.:::....|:..
  Rat   161 ERAEEIYPVMEKEGRTRLALIICNKKFDYLFD---RDDAETDILNMKELLQNLGYSVVIKENLTA 222

  Fly   243 DQFFKLLTMVTSSSYVQNTECFVMVLMTHGNSVEG----KEKVEFCDGSVVDMQKIKDHFQTAKC 303
            .:....|.........|:::...:|.|:|| .:||    |.:.:..|  |:....|...|..:.|
  Rat   223 QEMETELMKFAGRPEHQSSDSTFLVFMSHG-ILEGICGVKHRNKKPD--VLHDDTIFTIFNNSNC 284

  Fly   304 PYLVNKPKVLMFPFCRGDEYDLGHPKNQGNLMEPVYTAQEEKWPDTQTEGIPS-----PSTNVPS 363
            |.|.||||:|:...|||        ::.|.:.  |.|::.....||..|.:.|     ..|....
  Rat   285 PSLRNKPKILIMQACRG--------RHTGTIW--VSTSKGIATADTDEECVLSHRWNNSITKAHV 339

  Fly   364 LADTLVCYANTPGYVTHRDLDTGSWYIQKFCQVMADHAHDTDLEDILKKT--SEAVGNKRTKKGS 426
            ..|.:...::||..::.:...:||.:|.|.......:.....||:|.:|.  |..|..:.|    
  Rat   340 ETDFIAFKSSTPHNISWKVGKSGSLFISKLIDCFKKYCWCYHLEEIFRKVQYSFEVPGELT---- 400

  Fly   427 MQTGAYDNLGFNKKLYFNPG 446
             |....:.:...:..|..||
  Rat   401 -QMPTIERVSMTRYFYLFPG 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 58/267 (22%)
Casp12NP_569106.1 CARD_CASP1-like 6..88 CDD:260036
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..115 7/15 (47%)
CASc 167..418 CDD:214521 59/271 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346262
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.