DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and LOC1279251

DIOPT Version :10

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_318945.4 Gene:LOC1279251 / 1279251 VectorBaseID:AGAMI1_001927 Length:295 Species:Anopheles gambiae


Alignment Length:44 Identity:8/44 - (18%)
Similarity:16/44 - (36%) Gaps:6/44 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IYRGRKRKEPSPEE------TRASNVARHKEETHMTELSLAIAP 82
            ::.|...|:...|:      :..|.:....|..::....||..|
Mosquito    58 VFAGFNAKKADAEKSCQAVGSTLSGIQNKNEALYIQTALLAQIP 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018 8/44 (18%)
CASc 186..443 CDD:237997
LOC1279251XP_318945.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.