DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and Casp8

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001264855.1 Gene:Casp8 / 12370 MGIID:1261423 Length:500 Species:Mus musculus


Alignment Length:342 Identity:84/342 - (24%)
Similarity:145/342 - (42%) Gaps:53/342 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 SVDESDSRPPFISLNERRTSRKSADIVDTPSPEASEGPC---VSKLRNEPLGALTPYVGVVDGPE 169
            |::..:..||.: |:|  .|.|.|::.|:|..:.||...   |.:::|:|.|    |..:::..:
Mouse   208 SLEGREELPPSV-LDE--MSLKMAELCDSPREQDSESRTSDKVYQMKNKPRG----YCLIINNHD 265

  Fly   170 VKKSKKIHGGDSAILGTYKMQSRFNRGVLLMVNIMDYPDQNRRRIGAEKDSKSLIHLFQELNFTI 234
            ..|:::      .|....||:.                     |.|.:.|.::|...|:||:|.|
Mouse   266 FSKARE------DITQLRKMKD---------------------RKGTDCDKEALSKTFKELHFEI 303

  Fly   235 FPYGNVNQDQFFKLLTMVTSSSYVQNTECFVMVLMTHGNSVEGKEKVEFCDGSVVDMQKIKDHFQ 299
            ..|.:...::..::|....|:.: :|.:||:..:::||:    |..|...||....:..:..:|.
Mouse   304 VSYDDCTANEIHEILEGYQSADH-KNKDCFICCILSHGD----KGVVYGTDGKEASIYDLTSYFT 363

  Fly   300 TAKCPYLVNKPKVLMFPFCRGDEYDLGHPKNQGNLMEPVYTAQEEKWPDTQTEGIPSPSTNVPSL 364
            .:|||.|..|||:.....|:|..:..|.|...|          .|:...|......|....:|..
Mouse   364 GSKCPSLSGKPKIFFIQACQGSNFQKGVPDEAG----------FEQQNHTLEVDSSSHKNYIPDE 418

  Fly   365 ADTLVCYANTPGYVTHRDLDTGSWYIQKFCQVMADHA-HDTDLEDILKKTSEAVGNKRTKKGSMQ 428
            ||.|:..|.....|::||...|:||||..||.:.:.. ...|:..||...:..|.||..::...:
Mouse   419 ADFLLGMATVKNCVSYRDPVNGTWYIQSLCQSLRERCPQGDDILSILTGVNYDVSNKDDRRNKGK 483

  Fly   429 TGAYDNLGFNKKLYFNP 445
            ..........|||:|.|
Mouse   484 QMPQPTFTLRKKLFFPP 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 63/257 (25%)
Casp8NP_001264855.1 DED_Caspase_8_r1 23..104 CDD:260041
DD 118..199 CDD:387368
CASc 247..499 CDD:237997 70/297 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842781
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.