DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and Casp3

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001271338.1 Gene:Casp3 / 12367 MGIID:107739 Length:277 Species:Mus musculus


Alignment Length:312 Identity:76/312 - (24%)
Similarity:123/312 - (39%) Gaps:77/312 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 VDGPEVK--KSKKIHGGDSAILGTYKMQSRFNRGVLLMVNIMDYPD-------QNRR-------- 212
            ||...:.  :.|.|||..|...|.| :.|.:.         ||||:       .|:.        
Mouse     8 VDSKSINNFEVKTIHGSKSVDSGIY-LDSSYK---------MDYPEMGICIIINNKNFHKSTGMS 62

  Fly   213 -RIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQFFKLLTMVTSSSYVQNTECFVMVLMTHGNSVE 276
             |.|.:.|:.:|...|..|.:.:....::.::...:|:..|:...:.:.:. ||.|:::||:   
Mouse    63 SRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVSKEDHSKRSS-FVCVILSHGD--- 123

  Fly   277 GKEKVEFCDGSVVDMQKIKDHFQTAKCPYLVNKPKVLMFPFCRGDEYDLGHPKNQGNLMEPVYTA 341
              |.|.:.....|:::|:...|:...|..|..|||:.:...|||.|.|.|...:.|        .
Mouse   124 --EGVIYGTNGPVELKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSG--------T 178

  Fly   342 QEEKWPDTQTEGIPSPSTNVPSLADTLVCYANTPGYVTHRDLDTGSWYIQKFCQVMADHAHDTDL 406
            .||           .....:|..||.|..|:..|||.:.|:...|||:||..|.::..:||..:.
Mouse   179 DEE-----------MACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLKLYAHKLEF 232

  Fly   407 EDILKKTSEAVGNK----------RTKKG-----SMQTGAYDNLGFNKKLYF 443
            ..||.:.:..|..:          ..||.     ||.|         |:|||
Mouse   233 MHILTRVNRKVATEFESFSLDSTFHAKKQIPCIVSMLT---------KELYF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 66/287 (23%)
Casp3NP_001271338.1 CASc 37..277 CDD:214521 66/282 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.