DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and Casp14

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_033939.1 Gene:Casp14 / 12365 MGIID:1335092 Length:257 Species:Mus musculus


Alignment Length:245 Identity:65/245 - (26%)
Similarity:105/245 - (42%) Gaps:33/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 RRRIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQFFKLLT--MVTSSSYVQNTECFVMVLMTHGN 273
            :.|.|:|.|.::|..:|:.|.|......:....||.:.|.  ..|..::.:...|..:|||.||.
Mouse    31 KAREGSEVDMEALERMFRYLKFESTMKRDPTAQQFLEELDEFQQTIDNWEEPVSCAFVVLMAHGE 95

  Fly   274 SVEGKEKVEFCDGSVVDMQKIKDHFQTAKCPYLVNKPKVLMFPFCRGDEYDLGHPKNQGNLMEPV 338
              ||..|.|  |..:|.::.:.:......|..|..||||.:...|||:..|.|. :.:||     
Mouse    96 --EGLLKGE--DEKMVRLEDLFEVLNNKNCKALRGKPKVYIIQACRGEHRDPGE-ELRGN----- 150

  Fly   339 YTAQEEKWPDTQTEG-----IPSPSTNVPSLADTLVCYANTPGYVTHRDLDTGSWYIQKFCQVMA 398
                ||...|.:..|     :.:...::|:..|||..|:...||:::|..:.||.:||....|..
Mouse   151 ----EELGGDEELGGDEVAVLKNNPQSIPTYTDTLHIYSTVEGYLSYRHDEKGSGFIQTLTDVFI 211

  Fly   399 DHAHDTDLEDILKKTSEAVGNKRTKKGSMQTGAYDNLG------FNKKLY 442
             |...:.|| :.::.:..:.|...    ||.|....:.      ..||||
Mouse   212 -HKKGSILE-LTEEITRLMANTEV----MQEGKPRKVNPEVQSTLRKKLY 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 65/245 (27%)
Casp14NP_033939.1 CASc 10..257 CDD:237997 65/245 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842795
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1092723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.