DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and Cflar

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001029036.1 Gene:Cflar / 117279 RGDID:620847 Length:480 Species:Rattus norvegicus


Alignment Length:420 Identity:86/420 - (20%)
Similarity:165/420 - (39%) Gaps:112/420 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EHIRKNLNILVEWTNYERLAME----CVQQGILTVQMLRNTQDLNGKPFNMDEK---DVRVEQHR 73
            :|:.::.:::   ::|..|.||    ..|..:.::..|  |:|..|:.....:|   |:.:|   
  Rat    86 DHLCRSPHLV---SDYRVLLMEIGENLNQSDVSSLIFL--TKDYTGRGKVAKDKSFLDLVIE--- 142

  Fly    74 RLLLKITQRGPTAYNLLINALRNINCLDAAVLLESVDESDSRPPFISLNERRTSRKSADIVDTPS 138
              |.|:...|....|||...|::|:.:|....::...:|         ::...|..:|.....|.
  Rat   143 --LEKLNLIGSDQLNLLEKCLKSIHRIDLKTKIQKYTQS---------SQEARSNMNALQASLPK 196

  Fly   139 PEASEGPCVSKLRN----EPLGALTPYVGVVDGPEVKKSKKIHGGDSAIL-------GTYKMQSR 192
            ....|....|:|:|    ||  ....:.|:...| ||.|.:    :|.|.       .:|:|||:
  Rat   197 LSIKEHLYNSRLQNGRSKEP--RFVEHHGIQRKP-VKTSIQ----ESGIFLPPHIHEESYRMQSK 254

  Fly   193 FNRGVLLMVNIMDYPDQNRRRIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQFFKLLTMVTSSSY 257
             ..|:.|:::.          ||  .|::.|...|..|.:.:.|:...:..:..:::...::.:.
  Rat   255 -PLGICLIIDC----------IG--NDTEYLRETFTSLGYRVQPFLFPSSHEITQIVRRFSNMTQ 306

  Fly   258 VQNTECFVMVLMTHG--NSVEGKEKVEFCDGSVVDMQKIKDHFQTAKCPYLVNKPKVLMFPFCRG 320
            .|:.:.||.||::.|  .|:.|.::|.    |...::.:||.|:...||.|..|||:...     
  Rat   307 HQDYDSFVCVLVSRGGSQSMMGVDQVY----SGFSLENVKDMFKGDMCPSLRGKPKLFFI----- 362

  Fly   321 DEYDLGHPKNQGNLMEPVYTAQEEKWPDTQTEGIPSPSTNVPSLADTLVCYANTPGYVTHRDLD- 384
                    :|        |.|.|:.  ..:.:|        |::.:....:.:.....||.|.| 
  Rat   363 --------QN--------YEALEDN--SLEVDG--------PAIKNVNSRHLHPRHCTTHPDADI 401

  Fly   385 -----------------TGSWYIQKFCQVM 397
                             :.|.|:||..|::
  Rat   402 FWSLCTADVSRLEQPSSSLSVYLQKLSQLL 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018 21/94 (22%)
CASc 186..443 CDD:237997 47/232 (20%)
CflarNP_001029036.1 DED_c-FLIP_r1 6..85 CDD:260044
DED_c-FLIP_r2 96..176 CDD:260046 21/86 (24%)
CASc 249..479 CDD:412128 47/231 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346256
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.