DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and CARD16

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_011540885.1 Gene:CARD16 / 114769 HGNCID:33701 Length:265 Species:Homo sapiens


Alignment Length:182 Identity:34/182 - (18%)
Similarity:64/182 - (35%) Gaps:60/182 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 DVRVEQHRRLLLKITQRGPTAYNLLINALRNINCLDAAVLLESVDESDSRPPFISLNERRTSRKS 130
            |..:::.|:|.  |...|....|.|::.|     |...||.:...|...|.....:::.|.    
Human    71 DKVLKEKRKLF--IHSMGEGTINGLLDEL-----LQTRVLNQEEMEKVKRENATVMDKTRA---- 124

  Fly   131 ADIVDTPSPEASEG--PCVSKLRN------EPLGALTPYVGVVDGPEV----------------- 170
              ::|:..|:.::.  .|::.:..      |.||.......|.|.|.:                 
Human   125 --LIDSVIPKGAQACQICITYICEEDSYLAETLGLSAALQAVQDNPAMPTCSSPEGRIKLCFLED 187

  Fly   171 ------KKSKKIHGGDSAI-------LGTYKMQ---------SRFNRGVLLM 200
                  :|.::.|..::.|       .|:::||         .||.|.:||:
Human   188 AQRIWKQKLQRCHVQNTIIKWSERYTSGSFEMQWLFLRTNFIERFWRNILLL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018 10/39 (26%)
CASc 186..443 CDD:237997 7/24 (29%)
CARD16XP_011540885.1 CARD_CASP1-like 73..155 CDD:260036 17/94 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.