DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and casp17

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_017213601.1 Gene:casp17 / 101886133 ZFINID:ZDB-GENE-190425-2 Length:276 Species:Danio rerio


Alignment Length:241 Identity:65/241 - (26%)
Similarity:112/241 - (46%) Gaps:33/241 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 NRGVLLMVNIMDYPDQ-NRRRIGAEKDSKSLIHLFQELNFTIFPYGNVNQD-QFFKLLTMVTSSS 256
            ||.:::.|... |||. .|.|.||:||::.|..:..:|.|::    ::..| :..:::......|
Zfish    17 NRALIVSVENF-YPDALLRNRPGAKKDTQRLHKILMKLGFSV----DIRVDMEAGEIIEAFKQES 76

  Fly   257 YVQNTECFVMVLMTHGNSVEGKEKVEF-CDGSVVDMQKIKDHFQTAKCPYLVNKPKVLMFPFCRG 320
            .....||||.::.:|     |:|.|.| |||..|::.:|...|::   |.:.:|.|:.:...|||
Zfish    77 EQTVKECFVGIISSH-----GEEGVVFGCDGRAVNLAEIYSCFRS---PIMKDKSKLFLIQACRG 133

  Fly   321 DEYDLGHPKNQGNLMEPVYTAQEEKWPDTQTEGIPSPSTNVPSLADTLVCYANTPGYVTHRDLDT 385
            .:.|      .|..:|...::.||       :.|.|...::|  .||.|.||.:|||..... ..
Zfish   134 GDLD------GGVQVETDSSSSEE-------QDILSELLSIP--IDTAVTYATSPGYAAFMH-PL 182

  Fly   386 GSWYIQKFCQVM-ADHAHDTDLEDILKKTSEAVGNKRTKKGSMQTG 430
            ||..||..|.:: :|...|.::..:|.:.:..|......:|.:..|
Zfish   183 GSVLIQTLCDLLESDGGPDLEITKLLTRLNHQVAYNFQARGKILGG 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 65/241 (27%)
casp17XP_017213601.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587226
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.