DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and CASP12

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001177945.2 Gene:CASP12 / 100506742 HGNCID:19004 Length:341 Species:Homo sapiens


Alignment Length:251 Identity:53/251 - (21%)
Similarity:92/251 - (36%) Gaps:41/251 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 RIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQFFKLLTMVTSSSYVQNTECFVMVLMTHG--NSV 275
            |.|:|.|...:..|.:.|.:::....|:...:....|....:....|:::...:|.|:|.  |.:
Human   114 RNGSELDLLGMRDLLENLGYSVVIKENLTAQEMETALRQFAAHPEHQSSDSTFLVFMSHSILNGI 178

  Fly   276 EGKEKVEFCDGSVVDMQKIKDHFQTAKCPYLVNKPKVLMFPFCRGD-------EYDLGHPKN--- 330
            .|.:..: .:..|:....|.:.|....|..|.:||||::...|||:       ..|.|....   
Human   179 CGTKHWD-QEPDVLHDDTIFEIFNNRNCQSLKDKPKVIIMQACRGNGAGIVWFTTDSGKASADTH 242

  Fly   331 ----QGNLMEPVYT-AQEEKWPDTQTEGIPSPSTNVPSLADTLVCYANTPGYVTHRDLDTGSWYI 390
                |||:.....| |..||                    |.:...::||..|:.|....||.:|
Human   243 GRLLQGNICNDAVTKAHVEK--------------------DFIAFKSSTPHNVSWRHETNGSVFI 287

  Fly   391 QKFCQVMADHAHDTDLEDILKKTSEAVGNKRTKKGSMQTGAYDNLGFNKKLYFNPG 446
            .:......:::....||:|.:|...:.   .|.....|....:.|...:..|..||
Human   288 SQIIYYFREYSWSHHLEEIFQKVQHSF---ETPNILTQLPTIERLSMTRYFYLFPG 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 50/246 (20%)
CASP12NP_001177945.2 CARD_CASP1-like 6..88 CDD:260036
CASc 103..339 CDD:214521 51/248 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152742
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.