DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dronc and si:ch211-195h23.3

DIOPT Version :9

Sequence 1:NP_524017.1 Gene:Dronc / 39173 FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_021334238.1 Gene:si:ch211-195h23.3 / 100170660 ZFINID:ZDB-GENE-070912-174 Length:1001 Species:Danio rerio


Alignment Length:343 Identity:66/343 - (19%)
Similarity:118/343 - (34%) Gaps:97/343 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PPELEIG-----MPKRHREHIRKNLNILVEWTNYERLAMECVQQGILTVQMLRNTQDLNGKPFNM 62
            |.||:|.     .|..:|:: |..||.|:  ::|.......::........|:..:|:..:....
Zfish   441 PLELKISDGSYLRPGGYRQY-RALLNQLI--SDYRARTESQIKHEEALWMFLQGKEDVGNQILQA 502

  Fly    63 D--------EKDVRV------EQHRRLL----------------------------LKITQRGPT 85
            |        ||:|::      :||:|.|                            ||...:...
Zfish   503 DESLSAAEQEKEVQILKNEILQQHQRGLEEQKHLEEQIIQQMKRNQEKIRRDDDQALKAKHKHEE 567

  Fly    86 AYNLLINALRNINCLDAAVLLESVDESDSRPPFISLNERRTSRKSADIVDTPSPEASEGPCVSKL 150
            |..::....:     |....:...|||      :|..|:....||  :...|..|:|.|...|:.
Zfish   568 ASWMIWKGNK-----DVGNKIVQADES------LSAVEQEKEGKS--LGSPPRAESSTGQPTSES 619

  Fly   151 RNEPLGALTP-YVGVVDGPEVKKSKKI---HGGDSAILGTYKMQSRFNRGVLLMVNIMDYPDQNR 211
            ..|    .|| .:..||..:.|.:.:.   |.|            :|...:..:|.:||...:..
Zfish   620 AEE----FTPELIQTVDEDKHKNTYRFVCPHAG------------QFQCSLTSLVFVMDGEGELL 668

  Fly   212 RRIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQFFKLLTMVTSSSYVQNTECFVMVLMTHGNSVE 276
            .|: ...|.:.|..|.|     :.|.|.:..   .|......|..::.:.|.|     :.|::::
Zfish   669 YRV-VSWDPRLLDGLGQ-----MQPAGPLYD---VKCFNGSISKLHLPHCEIF-----SEGDNMD 719

  Fly   277 GKEKVEFCDGSVVDMQKI 294
            |.....|..|::..:|.|
Zfish   720 GLAVAHFTGGNMEIVQPI 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018 19/129 (15%)
CASc 186..443 CDD:237997 21/109 (19%)
si:ch211-195h23.3XP_021334238.1 P-loop_NTPase 51..307 CDD:328724
GBP_C 315..602 CDD:293879 32/176 (18%)
coiled coil 573..584 CDD:293879 1/15 (7%)
coiled coil 593..602 CDD:293879 3/10 (30%)
FIIND 645..885 CDD:316110 23/119 (19%)
CARD_ASC_NALP1 910..991 CDD:260039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.