DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nudE and CASP

DIOPT Version :9

Sequence 1:NP_001097569.1 Gene:nudE / 39169 FlyBaseID:FBgn0036059 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_566611.1 Gene:CASP / 821377 AraportID:AT3G18480 Length:689 Species:Arabidopsis thaliana


Alignment Length:361 Identity:71/361 - (19%)
Similarity:138/361 - (38%) Gaps:97/361 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MFNSV----EDECRYWKERSKQYHKEWTDVKQEYDE----------FVEQSREMEIEMDATLDQK 56
            ||||:    ::|.....:|:|.....:.::.|:..|          ..||.|             
plant    84 MFNSLLKGYQEEVDNITKRAKFGENAFLNIYQKLYEAPDPFPALASIAEQDR------------- 135

  Fly    57 QSIIKDLTAKLTMFERENESLKLKLESHGIDMSNMEKQLETVK---------------KDRDTMK 106
                     ||:..|.||..:|::||....:.::::.|..|::               |.::.::
plant   136 ---------KLSEVESENRKMKVELEEFRTEATHLKNQQATIRRLEERNRQLEQQMEEKIKEVVE 191

  Fly   107 VYLRQLEQKND-------DLERA----HRILNESIENFEKMLDQAYEKNALLELEV---DEKGLL 157
            :..|.|.::|.       |.|:|    .|...:|:...:|:.:.|  :|.|.||..   :|....
plant   192 IKQRNLAEENQKTMELLKDREQALQDQLRQAKDSVSTMQKLHELA--QNQLFELRAQSDEETAGK 254

  Fly   158 QEKLQRLMDETRDLKQELNVKSRFTPVVNGTSVPTAN-DT-NTVNSSMNSSASLPNGIVANGELV 220
            |.::..||||....:..|....|....:. :.:.||| || |..:.:::|::.|.|.:.|..:::
plant   255 QSEVSLLMDEVERAQTRLLTLEREKGHLR-SQLQTANEDTDNKKSDNIDSNSMLENSLTAKEKII 318

  Fly   221 KHDNAVATRATSVSVNALNGSLVNRN-----EYNQQHSLKNPENQINGNSMNPSSRTTALNIVAD 280
            ...|        :.::.:..:|.|..     |..:.:||.|.::.|............:..:|.|
plant   319 SELN--------MEIHNVETALANERESHVAEIKKLNSLLNKKDTIIEEMKKELQERPSAKLVDD 375

  Fly   281 MLRKL--------------NWDKALLCPECEKFRCM 302
            :.:|:              :||.|....|..|...:
plant   376 LRKKVKILQAVGYNSIEAEDWDAATTGEEMSKMESL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nudENP_001097569.1 NUDE_C 129..>177 CDD:282704 14/50 (28%)
CASPNP_566611.1 SMC_prok_B <130..432 CDD:274008 62/315 (20%)
CASP_C 438..667 CDD:400477
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.