DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nudE and noca-2

DIOPT Version :9

Sequence 1:NP_001097569.1 Gene:nudE / 39169 FlyBaseID:FBgn0036059 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_509950.3 Gene:noca-2 / 181354 WormBaseID:WBGene00011444 Length:794 Species:Caenorhabditis elegans


Alignment Length:326 Identity:73/326 - (22%)
Similarity:127/326 - (38%) Gaps:76/326 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EDECRYWKERSKQYHKEWTDVKQEYDEFVEQSREMEIEMDATLDQ-KQSIIKDLTAKLTMFEREN 74
            |..|.:.:   ||.|            ...|.|.|.||   .||| :|||......:|...|...
 Worm   272 EMRCEHMQ---KQIH------------IANQRRNMLIE---ELDQNQQSIEASYNNRLKEMEERC 318

  Fly    75 ESL------KLKLESHGI--DMSNMEKQLETVKKDRDTMKVYLRQLEQKN--------------D 117
            ...      |.::|.|.:  ::.|:||.|..|:::..::|..|:.:|:.|              :
 Worm   319 RGRIAAMEEKFRMERHEMQKEIENIEKDLSLVRQNETSLKNKLQLVERHNKRITTELEDQTDAVN 383

  Fly   118 DLERAHRILNESIENFEKMLDQAYEKNALL-------ELEVDEKGLLQEKLQRLMDETR-DLKQE 174
            .||:.:|.|...:.  :|...:..|.||.:       ||.|.....|:|||:.:...:: ||..|
 Worm   384 ALEQENRELRADLR--KKQQFRVSEDNAKIIAWKQKVELMVAHNKRLREKLRDISKNSKCDLSPE 446

  Fly   175 LNVKSRFTPVVNGTSVPTANDTNTVNSSMNSSASLPNGIV----------ANGELVKHDNAVATR 229
            ..:  ::||......:...........:::...|.|..|.          ....:.:::|....:
 Worm   447 AYI--QWTPPFRSQLLLIRKRRIQKGDTLSEMDSEPESIFYRRRRKRLRKKRDRMRRYENIHNIQ 509

  Fly   230 ATSVSVNALNGSLVNRNEYNQQHSLKNPENQ-----INGNSMNPSSRTTALNIVADMLRKLNWDK 289
            :.|..:|. :|:|...:| |.:.||.:|.::     :|.|..|.||....:|      |..|.|:
 Worm   510 SGSSRINE-DGNLTVFSE-NSRKSLLSPRSRGMLTSLNDNDQNLSSDRLLIN------RAKNTDR 566

  Fly   290 A 290
            |
 Worm   567 A 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nudENP_001097569.1 NUDE_C 129..>177 CDD:282704 14/55 (25%)
noca-2NP_509950.3 SMC_prok_A <258..>437 CDD:274009 45/184 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5149
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.