DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nudE and LOC105946701

DIOPT Version :9

Sequence 1:NP_001097569.1 Gene:nudE / 39169 FlyBaseID:FBgn0036059 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_031761614.1 Gene:LOC105946701 / 105946701 -ID:- Length:120 Species:Xenopus tropicalis


Alignment Length:113 Identity:41/113 - (36%)
Similarity:67/113 - (59%) Gaps:5/113 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 ENESLKLKLESHGIDMSNMEKQLETVKKDRDTMKVYLRQLEQKNDDLERAHRILNESIENFEKML 137
            ::|.|:.:.......:|.:|.:|...:..:|.:..|:|:|||.|:|||||.|....|:|:||:.|
 Frog     8 DHEKLEHQYAQSYKQVSLLEDELARARSIKDQLHKYVRELEQANNDLERAKRATIVSLEDFEQRL 72

  Fly   138 DQAYEKNALLELEVDEKGLLQEKLQRLMDETRDLKQELNVKSRFTPVV 185
            :||.::||..|.|:|||..|...:|||.||.|.:     :::|...|:
 Frog    73 NQAIKRNAFFESELDEKESLLVSVQRLKDEARGI-----IRNRILAVI 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nudENP_001097569.1 NUDE_C 129..>177 CDD:282704 21/47 (45%)
LOC105946701XP_031761614.1 PRKG1_interact 25..108 CDD:406350 36/87 (41%)
NUDE_C 64..>104 CDD:398511 20/39 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1082224at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.