DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6707 and PIP4P2

DIOPT Version :9

Sequence 1:NP_648372.1 Gene:CG6707 / 39168 FlyBaseID:FBgn0036058 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_061180.1 Gene:PIP4P2 / 55529 HGNCID:25452 Length:257 Species:Homo sapiens


Alignment Length:259 Identity:113/259 - (43%)
Similarity:151/259 - (58%) Gaps:28/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SVDAVDEGADNPGSNSSVATNEDGNGAPTAVPCIGPD----ELPPPYQ--QSTNTGGVPMVTCRV 78
            :.|.|||      .:..::.:..||..|||.|.:...    ||||||.  .|.:..|:|::.|||
Human     2 AADGVDE------RSPLLSASHSGNVTPTAPPYLQESSPRAELPPPYTAIASPDASGIPVINCRV 60

  Fly    79 CQHMIDITTKREQHVVKCTHCNEATPIRNAPAGKKYVRCPCNCLLICKSSSQRIACPRPNCKRII 143
            ||.:|::..|..|||||||.|||||||:|.|.||||||||||||||||.:|:||.||||||:|||
Human    61 CQSLINLDGKLHQHVVKCTVCNEATPIKNPPTGKKYVRCPCNCLLICKDTSRRIGCPRPNCRRII 125

  Fly   144 NLAP-------SPVTPPVPTMPGMCRVTCGHCSDTFL-----FNTYHNALARCPHCRKVSSVGSR 196
            ||.|       .|..|.:|..|...||.||||.:|||     |||    ||:||||:|:|||||.
Human   126 NLGPVMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFNT----LAKCPHCKKISSVGSA 186

  Fly   197 FANSRAVMFAIVALVFLITGIAVTIGTYSIASDHGGMYFLYVALFVISGCMLARSAYYFRLKVS 260
            ....|...:..:.::.:..|:.:|:||...|......|..:...:::....|.|:.|:..::||
Human   187 LPRRRCCAYITIGMICIFIGVGLTVGTPDFARRFRATYVSWAIAYLLGLICLIRACYWGAIRVS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6707NP_648372.1 Tmemb_55A 3..260 CDD:286827 111/257 (43%)
PIP4P2NP_061180.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 15/46 (33%)
Tmemb_55A 7..250 CDD:401660 109/252 (43%)
CX5R motif 107..113 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160316
Domainoid 1 1.000 232 1.000 Domainoid score I2426
eggNOG 1 0.900 - - E1_KOG4684
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 233 1.000 Inparanoid score I3427
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48644
OrthoDB 1 1.010 - - D1346704at2759
OrthoFinder 1 1.000 - - FOG0002563
OrthoInspector 1 1.000 - - otm41804
orthoMCL 1 0.900 - - OOG6_106114
Panther 1 1.100 - - O PTHR21014
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1921
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.