DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6707 and pip4p2

DIOPT Version :9

Sequence 1:NP_648372.1 Gene:CG6707 / 39168 FlyBaseID:FBgn0036058 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001005000.1 Gene:pip4p2 / 448483 XenbaseID:XB-GENE-951972 Length:276 Species:Xenopus tropicalis


Alignment Length:279 Identity:113/279 - (40%)
Similarity:148/279 - (53%) Gaps:49/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SVDAVDEGADNPGSNSSVATNEDGNGAPTAVPCIGPD----ELPPPYQ--QSTNTGGVPMVTCRV 78
            :.|.:||       .|.:.:...||..|||.|.:..:    ||||||.  .|.:..|||::.|||
 Frog     2 AADGIDE-------RSPLISPSSGNVTPTAPPYLQQNNLQAELPPPYTAIASPDASGVPVINCRV 59

  Fly    79 CQHMIDITTKREQHVVKCTHCNEATPIRNAPAGKKYVRCPCNCLLICKSSSQRIACPRPNCKRII 143
            ||.:|::..|..|||||||.|||||||:..|.||||||||||||||||..|:||.||||||:|||
 Frog    60 CQSLINLDGKLHQHVVKCTVCNEATPIKTPPLGKKYVRCPCNCLLICKDISRRIGCPRPNCRRII 124

  Fly   144 NLAP-------SPVTPPVPTMPGMCRVTCGHCSDTFL-----FNTYHNALARCPHCRKV------ 190
            ||.|       .|..|.:|..|...||.||||.:|||     |||    ||:||||:|:      
 Frog   125 NLGPVMLIPEEQPAQPALPVQPEGTRVVCGHCGNTFLWMELRFNT----LAKCPHCKKMNCQVPR 185

  Fly   191 --------------SSVGSRFANSRAVMFAIVALVFLITGIAVTIGTYSIASDHGGMYFLYVALF 241
                          |||||.....|...:..:.::.:..|:.:|:||...|......|..:...:
 Frog   186 IQGKNGSAPGKAFRSSVGSALPRRRCCTYITMGMICIFIGVGLTVGTQDFARRFHATYVSWAVAY 250

  Fly   242 VISGCMLARSAYYFRLKVS 260
            ::....|.|:.|:..:|.|
 Frog   251 LVGLVCLIRACYWGAIKFS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6707NP_648372.1 Tmemb_55A 3..260 CDD:286827 112/277 (40%)
pip4p2NP_001005000.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 9/31 (29%)
Tmemb_55A 7..269 CDD:370693 111/272 (41%)
CX5R motif 106..112 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 220 1.000 Domainoid score I2572
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 224 1.000 Inparanoid score I3421
OMA 1 1.010 - - QHG48644
OrthoDB 1 1.010 - - D1346704at2759
OrthoFinder 1 1.000 - - FOG0002563
OrthoInspector 1 1.000 - - otm49028
Panther 1 1.100 - - O PTHR21014
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10236
SonicParanoid 1 1.000 - - X1921
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.