DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6707 and F52E1.9

DIOPT Version :9

Sequence 1:NP_648372.1 Gene:CG6707 / 39168 FlyBaseID:FBgn0036058 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001368695.1 Gene:F52E1.9 / 186115 WormBaseID:WBGene00018697 Length:181 Species:Caenorhabditis elegans


Alignment Length:113 Identity:28/113 - (24%)
Similarity:51/113 - (45%) Gaps:15/113 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 PSPVTPPVPTMPGMCRV-----------TCGHCSDTFLFNTYHNALARCPHCRKVSSVGSRFANS 200
            |....||.|..|.:.::           .|.||.:.|||:: .|.|..||.|....::|: :...
 Worm    49 PFEPLPPYPAGPNLSKIRYPREVTCPRYVCPHCDEQFLFHS-TNGLLTCPFCYTSIAIGT-YNRK 111

  Fly   201 RAVMFAIVALVFLITGIAVTIGTYSIASDHGGMYFLYVALFVISGCML 248
            :..:..:|..:.||..:.:||..::||.|.  :|....|:.:..|.::
 Worm   112 QMYLNFVVGTIVLIISMVMTILVFTIAKDQ--VYLSIPAIMLFFGAII 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6707NP_648372.1 Tmemb_55A 3..260 CDD:286827 28/113 (25%)
F52E1.9NP_001368695.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167750
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002563
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21014
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.