powered by:
Protein Alignment CG6709 and tppp3
DIOPT Version :9
Sequence 1: | NP_001097567.1 |
Gene: | CG6709 / 39166 |
FlyBaseID: | FBgn0036056 |
Length: | 117 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_958492.2 |
Gene: | tppp3 / 393825 |
ZFINID: | ZDB-GENE-040426-1909 |
Length: | 177 |
Species: | Danio rerio |
Alignment Length: | 70 |
Identity: | 15/70 - (21%) |
Similarity: | 29/70 - (41%) |
Gaps: | 10/70 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 ITRTQTGLIYMRYKKWR---LEYEDFLEVLNNLA------SDNNLAIDEMKQIMIDAGVPNGADV 112
:|.|...:::.:.|... :.||:|.:.|..|| .....|::.:.: :|:...|....|
Zfish 50 VTSTDVDIVFTKVKAKTSRVITYEEFQKALEELAPKRFKGQSKEEALESIYK-LIEGKEPTNIGV 113
Fly 113 VIVVK 117
..|.|
Zfish 114 TKVAK 118
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4070 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.