DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6709 and tppp3

DIOPT Version :9

Sequence 1:NP_001097567.1 Gene:CG6709 / 39166 FlyBaseID:FBgn0036056 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_958492.2 Gene:tppp3 / 393825 ZFINID:ZDB-GENE-040426-1909 Length:177 Species:Danio rerio


Alignment Length:70 Identity:15/70 - (21%)
Similarity:29/70 - (41%) Gaps:10/70 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ITRTQTGLIYMRYKKWR---LEYEDFLEVLNNLA------SDNNLAIDEMKQIMIDAGVPNGADV 112
            :|.|...:::.:.|...   :.||:|.:.|..||      .....|::.:.: :|:...|....|
Zfish    50 VTSTDVDIVFTKVKAKTSRVITYEEFQKALEELAPKRFKGQSKEEALESIYK-LIEGKEPTNIGV 113

  Fly   113 VIVVK 117
            ..|.|
Zfish   114 TKVAK 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6709NP_001097567.1 p25-alpha 41..>107 CDD:147609 11/58 (19%)
tppp3NP_958492.2 p25-alpha 13..171 CDD:283231 15/70 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.