DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6709 and AgaP_AGAP006242

DIOPT Version :9

Sequence 1:NP_001097567.1 Gene:CG6709 / 39166 FlyBaseID:FBgn0036056 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_556944.1 Gene:AgaP_AGAP006242 / 3290131 VectorBaseID:AGAP006242 Length:115 Species:Anopheles gambiae


Alignment Length:102 Identity:34/102 - (33%)
Similarity:63/102 - (61%) Gaps:2/102 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KPKKHTLDSLFLVYSNFQVIPTDIENEYFDSILLSQLDAWLEQAKLM-PNPITRTQTGLIYMRYK 70
            |.|..||.|:|.:::.::......:.: ...|||||.|.|::||.|: |...|.||||||:..::
Mosquito    11 KVKPPTLPSMFTLFAKYRPTLNSFQGD-GKRILLSQSDCWMQQANLIGPKHFTLTQTGLIFFEFR 74

  Fly    71 KWRLEYEDFLEVLNNLASDNNLAIDEMKQIMIDAGVP 107
            |..|:|:::|:.|..|.::..::::|:|:.:.:.|.|
Mosquito    75 KSTLDYDEYLQFLALLCNEKQVSVEEVKEKLTNCGPP 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6709NP_001097567.1 p25-alpha 41..>107 CDD:147609 24/66 (36%)
AgaP_AGAP006242XP_556944.1 p25-alpha 21..>115 CDD:283231 29/92 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4070
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I7570
OMA 1 1.010 - - QHG26103
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0020171
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.