powered by:
Protein Alignment CG6709 and Tppp2
DIOPT Version :9
Sequence 1: | NP_001097567.1 |
Gene: | CG6709 / 39166 |
FlyBaseID: | FBgn0036056 |
Length: | 117 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001122106.1 |
Gene: | Tppp2 / 219038 |
MGIID: | 2684923 |
Length: | 170 |
Species: | Mus musculus |
Alignment Length: | 73 |
Identity: | 15/73 - (20%) |
Similarity: | 28/73 - (38%) |
Gaps: | 10/73 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 FLVYSNFQVIPTDIENEYFDSILLSQLDAWLEQAKLMPNPITRTQTGLIYMRYKKWR---LEYED 78
|.|:........:|.|:.| |.|....|....:| :|.|...:::.:.|... :.::.
Mouse 12 FAVFGESSSSSKEITNKNF-SKLCKDCDIMDGKA------VTSTDVDIVFSKVKAKNARTINFQQ 69
Fly 79 FLEVLNNL 86
|.|.:..|
Mouse 70 FQEAMKEL 77
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4070 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.