DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6709 and tppp-1

DIOPT Version :9

Sequence 1:NP_001097567.1 Gene:CG6709 / 39166 FlyBaseID:FBgn0036056 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_491219.1 Gene:tppp-1 / 171948 WormBaseID:WBGene00016321 Length:180 Species:Caenorhabditis elegans


Alignment Length:91 Identity:22/91 - (24%)
Similarity:41/91 - (45%) Gaps:18/91 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DDEDKPKKHTLDSLFLVYSNF-QVIPTDIENEYFDSILLSQLDAWLEQAKLMPN-PITRTQTGLI 65
            ||.|..|:      :..::.| ....|::..:.||.        ||:.|.::.| .||.|.||:.
 Worm    10 DDADVKKR------WDAFTKFGAATATEMTGKNFDK--------WLKDAGVLDNKAITGTMTGIA 60

  Fly    66 YMRY--KKWRLEYEDFLEVLNNLASD 89
            :.:.  .|.:..:::..:||..:|.|
 Worm    61 FSKVTGPKKKATFDETKKVLAFVAED 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6709NP_001097567.1 p25-alpha 41..>107 CDD:147609 14/52 (27%)
tppp-1NP_491219.1 p25-alpha 18..175 CDD:283231 18/77 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.