DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpB and PEF1

DIOPT Version :9

Sequence 1:NP_001246706.1 Gene:CalpB / 39165 FlyBaseID:FBgn0025866 Length:925 Species:Drosophila melanogaster
Sequence 2:NP_011572.2 Gene:PEF1 / 852949 SGDID:S000003290 Length:335 Species:Saccharomyces cerevisiae


Alignment Length:210 Identity:48/210 - (22%)
Similarity:90/210 - (42%) Gaps:27/210 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   738 RIAPSLPPPTPKEEDDPQRIALRRLFDSVAGSDEEV-------------DWQELKRILDHSMRDV 789
            |||.| |||....:..|.:: |:::..:...|.|:|             |.:...|:....::::
Yeast   123 RIASS-PPPLIHNQAVPAQL-LKKVAPASFDSREDVRDMQVATQLFHNHDVKGKNRLTAEELQNL 185

  Fly   790 MVGSDG--FSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTR--RTGSIDGFH 850
            :...|.  |...:|.:::.:....|.|.:...||.||...:..||.|:...|..  .|.|:..||
Yeast   186 LQNDDNSHFCISSVDALINLFGASRFGTVNQAEFIALYKRVKSWRKVYVDNDINGSLTISVSEFH 250

  Fly   851 LRGALNSAGYHLNNRLLNALAHRYG---SREG---QIPFDDFLMCAIKVRTFIEMFRERDTDNSD 909
              .:|...||.:...:......:|.   :|.|   ::.||.|:...:.:....::||:.||:...
Yeast   251 --NSLQELGYLIPFEVSEKTFDQYAEFINRNGTGKELKFDKFVEALVWLMRLTKLFRKFDTNQEG 313

  Fly   910 TAFFNLDDWLERTIY 924
            .|.....|:::.|:|
Yeast   314 IATIQYKDFIDATLY 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpBNP_001246706.1 PD-C2-AF1 33..225 CDD:286403
Drf_FH1 37..189 CDD:283903
Peptidase_C2 260..556 CDD:279042
Calpain_III 574..721 CDD:279416
EF-hand_7 759..825 CDD:290234 14/80 (18%)
EFh 761..826 CDD:298682 14/79 (18%)
FRQ1 827..>908 CDD:227455 21/88 (24%)
PEF1NP_011572.2 EFh_PEF_Group_I 161..329 CDD:320055 36/170 (21%)
EF-hand motif 161..190 CDD:320055 2/28 (7%)
EF-hand motif 198..227 CDD:320055 7/28 (25%)
EF-hand motif 228..257 CDD:320055 9/30 (30%)
EF-hand motif 264..298 CDD:320055 6/33 (18%)
EF-hand motif 300..328 CDD:320055 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I3060
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.