DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpB and CAPNS2

DIOPT Version :10

Sequence 1:NP_524016.4 Gene:CalpB / 39165 FlyBaseID:FBgn0025866 Length:925 Species:Drosophila melanogaster
Sequence 2:NP_115706.1 Gene:CAPNS2 / 84290 HGNCID:16371 Length:248 Species:Homo sapiens


Alignment Length:193 Identity:68/193 - (35%)
Similarity:111/193 - (57%) Gaps:15/193 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   744 PPPTPK--------EEDDPQRIALRRLFDSVAGSDEEVDWQELKRILDHSM---RDVMVGSDGFS 797
            ||||.:        |.::.:|  .|:.|..:||.|.||...:|..||:..:   :|:.  :||||
Human    60 PPPTQQHFTSVEASESEEVRR--FRQQFTQLAGPDMEVGATDLMNILNKVLSKHKDLK--TDGFS 120

  Fly   798 KDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHL 862
            .|..||:|:::|.|.:|:||||||:.|..:|.||:.|:|.||...:||:....|||||.:||:.|
Human   121 LDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQL 185

  Fly   863 NNRLLNALAHRYGSREGQIPFDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWLERTIYS 925
            |.:|...:..||.:.:|.:.|::|:.|.:::......|:..|.|.......::.:||:.|:||
Human   186 NEQLYQMIVRRYANEDGDMDFNNFISCLVRLDAMFRAFKSLDRDRDGLIQVSIKEWLQLTMYS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpBNP_524016.4 PHA03247 <40..207 CDD:223021
Peptidase_C2 260..556 CDD:459889
Calpain_III 579..716 CDD:460050
EFh_PEF_CalpA_B 758..925 CDD:320071 60/169 (36%)
EF-hand motif 758..786 CDD:320071 10/27 (37%)
EF-hand motif 799..829 CDD:320071 14/29 (48%)
EF-hand motif 830..860 CDD:320071 14/29 (48%)
EF-hand motif 866..894 CDD:320071 7/27 (26%)
EF-hand motif 895..925 CDD:320071 6/29 (21%)
CAPNS2NP_115706.1 EFh_PEF_CPNS1_2 80..248 CDD:320063 61/171 (36%)
EF-hand motif 80..108 CDD:320063 11/29 (38%)
EF-hand motif 122..152 CDD:320063 14/29 (48%)
EF-hand motif 153..183 CDD:320063 14/29 (48%)
EF-hand motif 189..217 CDD:320063 7/27 (26%)
EF-hand motif 218..248 CDD:320063 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.