DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpB and AT3G10300

DIOPT Version :9

Sequence 1:NP_001246706.1 Gene:CalpB / 39165 FlyBaseID:FBgn0025866 Length:925 Species:Drosophila melanogaster
Sequence 2:NP_001327262.1 Gene:AT3G10300 / 820192 AraportID:AT3G10300 Length:377 Species:Arabidopsis thaliana


Alignment Length:170 Identity:44/170 - (25%)
Similarity:79/170 - (46%) Gaps:18/170 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   729 EVGFGETDDRIAPS-LPPPTPKEEDDPQRIALRRLFDSVAGSDEEVDWQELKRILDHSMRDVMVG 792
            :..:|.....:.|| .||.|     ||..:|..:..|  ..:...:|.:||:..|...       
plant   146 QASYGSPFASLVPSAFPPGT-----DPNIVACFQAAD--RDNSGFIDDKELQGALSSY------- 196

  Fly   793 SDGFSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNS 857
            :..||...|..::.:.......::|.:||.:|...:..||::|:.:|..|:|.||...||.||.|
plant   197 NQSFSIRTVHLLMYLFTNSNVRKIGPKEFTSLFFSLQNWRSIFERFDKDRSGRIDTNELRDALMS 261

  Fly   858 AGYHLNNRLLNALAHRY---GSREGQIPFDDFLMCAIKVR 894
            .|:.::..:|:.|..::   |.|...|.:|:|:.|.:.|:
plant   262 LGFSVSPVILDLLVSKFDKSGGRNRAIEYDNFIECCLTVK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpBNP_001246706.1 PD-C2-AF1 33..225 CDD:286403
Drf_FH1 37..189 CDD:283903
Peptidase_C2 260..556 CDD:279042
Calpain_III 574..721 CDD:279416
EF-hand_7 759..825 CDD:290234 11/65 (17%)
EFh 761..826 CDD:298682 12/64 (19%)
FRQ1 827..>908 CDD:227455 23/71 (32%)
AT3G10300NP_001327262.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I2006
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.