DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpB and SRI

DIOPT Version :9

Sequence 1:NP_001246706.1 Gene:CalpB / 39165 FlyBaseID:FBgn0025866 Length:925 Species:Drosophila melanogaster
Sequence 2:NP_003121.1 Gene:SRI / 6717 HGNCID:11292 Length:198 Species:Homo sapiens


Alignment Length:176 Identity:66/176 - (37%)
Similarity:100/176 - (56%) Gaps:7/176 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   745 PPTPKEEDDPQRIALRRLFDSVAGSDEEVDWQELKRILDHSMRDVMVGSDGFSKDAVRSMVAMLD 809
            |..|.:..||    |...|.:|||.|.::|..||:|.|..|  .:..|...|:.:..|.||:|||
Human    25 PAFPGQTQDP----LYGYFAAVAGQDGQIDADELQRCLTQS--GIAGGYKPFNLETCRLMVSMLD 83

  Fly   810 KDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRY 874
            :|.||.:||.||:.|...:..||..|..:||.|:|::|...|:.||.:.|:.|:.:.:|::|.||
Human    84 RDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRY 148

  Fly   875 GSREGQIPFDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWLE 920
             |..|:|.|||::.|.:|:|...:.||.|||.......|..||:::
Human   149 -STNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpBNP_001246706.1 PD-C2-AF1 33..225 CDD:286403
Drf_FH1 37..189 CDD:283903
Peptidase_C2 260..556 CDD:279042
Calpain_III 574..721 CDD:279416
EF-hand_7 759..825 CDD:290234 27/65 (42%)
EFh 761..826 CDD:298682 27/64 (42%)
FRQ1 827..>908 CDD:227455 31/80 (39%)
SRINP_003121.1 EFh_PEF_sorcin 34..198 CDD:320062 63/167 (38%)
EF-hand motif 34..62 CDD:320062 13/33 (39%)
EF-hand motif 74..103 CDD:320062 14/28 (50%)
EF-hand motif 104..133 CDD:320062 11/28 (39%)
EF-hand motif 140..167 CDD:320062 12/27 (44%)
EF-hand motif 169..197 CDD:320062 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.