DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpB and capns1b

DIOPT Version :10

Sequence 1:NP_524016.4 Gene:CalpB / 39165 FlyBaseID:FBgn0025866 Length:925 Species:Drosophila melanogaster
Sequence 2:NP_001103176.1 Gene:capns1b / 560033 ZFINID:ZDB-GENE-030131-5206 Length:213 Species:Danio rerio


Alignment Length:198 Identity:73/198 - (36%)
Similarity:116/198 - (58%) Gaps:11/198 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   737 DRIAPSLPPPTPK--------EEDDPQRIALRRLFDSVAGSDEEVDWQELKRILDHSM-RDVMVG 792
            |:..||.||| ||        .|.|.:| ..|::|..:||.|.||..:||..||:..: :...:.
Zfish    18 DQFVPSDPPP-PKRPLAYASHNETDEER-QFRKVFQQLAGDDMEVSPKELMTILNKIISKHGDLK 80

  Fly   793 SDGFSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNS 857
            :||||.::.|||||::|.|.:|:||||||..|..:|.:|:|::|.||...:|.|....|.||..:
Zfish    81 TDGFSIESCRSMVAVMDSDSTGKLGFEEFNYLWNNIKRWQAIYKTYDADHSGVIGSDELPGAFKA 145

  Fly   858 AGYHLNNRLLNALAHRYGSREGQIPFDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWLERT 922
            ||:.||::|...:..||...:|.:.||:::.|.:::......|:..|.||:.|...::.:||:.|
Zfish   146 AGFPLNDQLFQLIVRRYSDEKGNMDFDNYIGCLVRLDAMCRAFKTLDKDNNGTIKVDIQEWLQLT 210

  Fly   923 IYS 925
            :||
Zfish   211 MYS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpBNP_524016.4 PHA03247 <40..207 CDD:223021
Peptidase_C2 260..556 CDD:459889
Calpain_III 579..716 CDD:460050
EFh_PEF_CalpA_B 758..925 CDD:320071 60/167 (36%)
EF-hand motif 758..786 CDD:320071 11/27 (41%)
EF-hand motif 799..829 CDD:320071 15/29 (52%)
EF-hand motif 830..860 CDD:320071 11/29 (38%)
EF-hand motif 866..894 CDD:320071 7/27 (26%)
EF-hand motif 895..925 CDD:320071 8/29 (28%)
capns1bNP_001103176.1 EFh_PEF_CPNS1_2 45..213 CDD:320063 60/167 (36%)
EF-hand motif 45..73 CDD:320063 11/27 (41%)
EF-hand motif 87..117 CDD:320063 15/29 (52%)
EF-hand motif 118..148 CDD:320063 11/29 (38%)
EF-hand motif 154..182 CDD:320063 7/27 (26%)
EF-hand motif 183..213 CDD:320063 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.