DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpB and CG17765

DIOPT Version :9

Sequence 1:NP_001246706.1 Gene:CalpB / 39165 FlyBaseID:FBgn0025866 Length:925 Species:Drosophila melanogaster
Sequence 2:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster


Alignment Length:181 Identity:53/181 - (29%)
Similarity:84/181 - (46%) Gaps:13/181 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   744 PPPTPKEEDDPQRIALRRLFDSVAGSDE--EVDWQELKRILDHSMRDVMVGSDGFSKDAVRSMVA 806
            |||......:.|.....:.:.|:...|.  :::..||:..|      |....|.||.:|.:.|::
  Fly    19 PPPGAFPPQNAQVSPQAQQWFSMVDRDRSGKINASELQAAL------VNGRGDHFSDNACKLMIS 77

  Fly   807 MLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALA 871
            |.|.|.||.:...|||.|...|.:|..|||.||...:|.|:...|..|....|:..:...:|.|.
  Fly    78 MFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLV 142

  Fly   872 HR---YGSREGQIPFDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWL 919
            .:   .|.:|  :..|.|::..::|:.|.|.||:|||..:.|.....:|:|
  Fly   143 KKSDPQGHKE--VSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpBNP_001246706.1 PD-C2-AF1 33..225 CDD:286403
Drf_FH1 37..189 CDD:283903
Peptidase_C2 260..556 CDD:279042
Calpain_III 574..721 CDD:279416
EF-hand_7 759..825 CDD:290234 19/67 (28%)
EFh 761..826 CDD:298682 20/66 (30%)
FRQ1 827..>908 CDD:227455 26/83 (31%)
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 39/143 (27%)
EFh 39..92 CDD:238008 16/58 (28%)
EFh 105..159 CDD:298682 15/55 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448315
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.