DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpB and Pef1

DIOPT Version :9

Sequence 1:NP_001246706.1 Gene:CalpB / 39165 FlyBaseID:FBgn0025866 Length:925 Species:Drosophila melanogaster
Sequence 2:NP_001007652.1 Gene:Pef1 / 297900 RGDID:1359536 Length:283 Species:Rattus norvegicus


Alignment Length:188 Identity:53/188 - (28%)
Similarity:87/188 - (46%) Gaps:20/188 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   745 PPTPKEED------DPQRIALRRLFDSV-AGSDEEVDWQELKRILDHSMRDVMVGSDGFSKDAVR 802
            ||.|..:.      ||:..:   .|.|| |.....:..:|||:.|.:|      ....|:.:...
  Rat   101 PPGPYGQGGVPPNVDPEAYS---WFQSVDADHSGYISLKELKQALVNS------NWSSFNDETCL 156

  Fly   803 SMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLL 867
            .|:.|.||.::||:....|.||...:.:|:.:|:.||...:|||....|:.||:..||:|:.:..
  Rat   157 MMINMFDKTKTGRIDVVGFSALWKFLQQWKNLFQQYDRDHSGSISSTELQQALSQMGYNLSPQFT 221

  Fly   868 NALAHRYGSREGQIP---FDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWLERT 922
            ..|..||.:|.. ||   .|.|:....:::...|.|||:||........:.:|::..|
  Rat   222 QLLVSRYCTRSA-IPAMQLDCFIKVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMT 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpBNP_001246706.1 PD-C2-AF1 33..225 CDD:286403
Drf_FH1 37..189 CDD:283903
Peptidase_C2 260..556 CDD:279042
Calpain_III 574..721 CDD:279416
EF-hand_7 759..825 CDD:290234 18/66 (27%)
EFh 761..826 CDD:298682 19/65 (29%)
FRQ1 827..>908 CDD:227455 27/83 (33%)
Pef1NP_001007652.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
9 X 9 AA approximate tandem repeat of [AP]-P-G-G-P-Y-G-G-P-P 21..108 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..114 3/12 (25%)
EF-hand_7 122..178 CDD:290234 17/61 (28%)
EFh 122..171 CDD:238008 16/54 (30%)
EF-hand_6 184..213 CDD:290141 10/28 (36%)
EF-hand_7 186..277 CDD:290234 27/91 (30%)
EFh 186..277 CDD:298682 27/91 (30%)
Required for interaction with PDCD6. /evidence=ECO:0000250|UniProtKB:Q9UBV8 203..283 22/77 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.