DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpB and clpr-3

DIOPT Version :9

Sequence 1:NP_001246706.1 Gene:CalpB / 39165 FlyBaseID:FBgn0025866 Length:925 Species:Drosophila melanogaster
Sequence 2:NP_492904.2 Gene:clpr-3 / 186784 WormBaseID:WBGene00010417 Length:308 Species:Caenorhabditis elegans


Alignment Length:261 Identity:57/261 - (21%)
Similarity:100/261 - (38%) Gaps:58/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 FFRVIPPDQDFQ------ENYAGIFHFKFWQYGKWVEVVIDDRLPTYNGELIYMHSTEKNEF--- 385
            |.|:...|..|.      |.:|.:  .|....|:|..:..|..||        |:.....|:   
 Worm    15 FIRLSSKDDVFAISDKECEKHAKL--LKLLADGEWKIIKTDFHLP--------MNKQSIEEYAWM 69

  Fly   386 -----WSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEWYDIKEAPPNLFSI--MMKAAER 443
                 |:|.:||.:|||.|||::|.......|....||..::.|:::.. .|..::  |:..|..
 Worm    70 IGKQTWAAFIEKGFAKLFGSYKSLSAKPIDVAFRKLTGAFSKNYELRSF-KNCDAVWDMIVEAHL 133

  Fly   444 GSMMGCSLEPDPHVLEAETPQ------GLIRGHAYSITKVCLMDISTPNRQGKLPMIRMRNPWGN 502
            ...:.|:.:..   |:.|:.:      |:.:.|||:|    |..:...|.:    ::::.|....
 Worm   134 AGFLLCTSKLS---LDEESAEYIFNSTGIKQNHAYAI----LNSVVFENHR----LVQIGNTHAC 187

  Fly   503 DAEWSGPWSDSSPEW--------RFIPEHTKEEIGLNFDRDGEFWMSFQDFLNHFDRVEICNLSP 559
            |     .|.:...||        :|..:..:.....:.| |..|||....:..||..:.:|....
 Worm   188 D-----KWKELHKEWNSLHYFYNKFSSKLPRRPYISHLD-DMSFWMDIDQYCEHFSSLTVCEYRK 246

  Fly   560 D 560
            |
 Worm   247 D 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpBNP_001246706.1 PD-C2-AF1 33..225 CDD:286403
Drf_FH1 37..189 CDD:283903
Peptidase_C2 260..556 CDD:279042 55/255 (22%)
Calpain_III 574..721 CDD:279416
EF-hand_7 759..825 CDD:290234
EFh 761..826 CDD:298682
FRQ1 827..>908 CDD:227455
clpr-3NP_492904.2 CysPc <40..242 CDD:381776 49/227 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158990
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.