DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpB and LOC101731595

DIOPT Version :9

Sequence 1:NP_001246706.1 Gene:CalpB / 39165 FlyBaseID:FBgn0025866 Length:925 Species:Drosophila melanogaster
Sequence 2:XP_031758228.1 Gene:LOC101731595 / 101731595 -ID:- Length:474 Species:Xenopus tropicalis


Alignment Length:488 Identity:190/488 - (38%)
Similarity:273/488 - (55%) Gaps:53/488 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 DFQSLRDSCLANGTMFEDPDFPATNASLMYSR-RPD----RYYEWLRPGDIADDPQFFVEGYSRF 304
            |::.||...|.....|||.:|||:.|||..:: .|:    :...||||.:|..:|:|...|.:||
 Frog    18 DYEQLRAQSLPPNPPFEDKEFPASQASLGSNKLGPESNTAKGIVWLRPSEIHPNPEFITSGATRF 82

  Fly   305 DVQQGELGDCWLLAAAANLTQDSTLFFRVIPPDQDFQENYAGIFHFKFWQYGKWVEVVIDDRLPT 369
            |:.|.:|||||:|::.|.||.:......|:|.||.|:.||||||||:|||.|.|.:||:||:|||
 Frog    83 DICQQDLGDCWILSSMACLTLNEEYLSLVVPQDQSFKNNYAGIFHFRFWQRGDWTDVVVDDKLPT 147

  Fly   370 YNGELIYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEWYDIKEAPPNLF 434
            .:.:|:::.|.::||||:||||||:|||:|||||:.|.....||||.||||.|.|.:|.||.:||
 Frog   148 TDKKLVFVKSAQENEFWAALLEKAFAKLYGSYEAIWGKNPILAMEDLTGGVCESYSLKSAPGDLF 212

  Fly   435 SIMMKAAERGSMMGCSLEPDPHVLEAETPQGLIRGHAYSITKVCLMDISTPNRQGKLPMIRMRNP 499
            ..:.::.....::.||.:...   |......::.||:||||..    ...|..:||:.:||:|||
 Frog   213 QTIQRSVRTQCLLTCSTDKKK---EGTEESSIVAGHSYSITGA----EEVPYGKGKVQLIRLRNP 270

  Fly   500 WGNDAEWSGPWSDSSPEWRFIPEHTKEEIGLNFDRDGEFWMSFQDFLNHFDRVEICNLSPDS-LT 563
            ||: |||.|.|.|..|||..:....|:.: ||...||||||.:.|.:..::.||||.::..| :.
 Frog   271 WGS-AEWKGAWRDDGPEWNDVTPEVKKAL-LNKMEDGEFWMPYADVVKEYNTVEICYVASSSGVN 333

  Fly   564 EDQQHSSRRKWEMSMFEGEWTSGVTAGGCRNFLETFWHNPQYIISLEDPDDED----DDGKCTAI 624
            ..:.|     |.::...|.|..|       |..|||..:|::...||.||::.    |...||.|
 Frog   334 MKEPH-----WSLTQTGGSWNKG-------NPAETFLADPRFRFKLEVPDEDQAAAGDAALCTVI 386

  Fly   625 VALMQKNRRSKRNVGIDCLTIGFAIYHL-TDRDMQVKPQGLNFFK----YRASVARSPHFINTRE 684
            ||||||. ..|.|:      :.|.:|.| .:...||..:.|...|    .:.:..::.|      
 Frog   387 VALMQKT-VPKDNI------LDFQLYELPKEVSAQVLVKDLKSIKDINANQRNSGKTKH------ 438

  Fly   685 VCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFS 717
                |::|.|.|||||...|||::.:|.|||||
 Frog   439 ----FRVPKGEYLIVPKPSDPNQDIDFCIRVFS 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpBNP_001246706.1 PD-C2-AF1 33..225 CDD:286403
Drf_FH1 37..189 CDD:283903
Peptidase_C2 260..556 CDD:279042 133/300 (44%)
Calpain_III 574..721 CDD:279416 50/153 (33%)
EF-hand_7 759..825 CDD:290234
EFh 761..826 CDD:298682
FRQ1 827..>908 CDD:227455
LOC101731595XP_031758228.1 Peptidase_C2 33..325 CDD:395523 133/300 (44%)
Calpain_III 337..470 CDD:412194 51/160 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D704215at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.