DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpB and pef1

DIOPT Version :9

Sequence 1:NP_001246706.1 Gene:CalpB / 39165 FlyBaseID:FBgn0025866 Length:925 Species:Drosophila melanogaster
Sequence 2:XP_002938526.1 Gene:pef1 / 100144965 XenbaseID:XB-GENE-1013238 Length:283 Species:Xenopus tropicalis


Alignment Length:243 Identity:62/243 - (25%)
Similarity:98/243 - (40%) Gaps:57/243 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   692 PPGHYLIVPST-FDPNEEGEFIIRVFSETRNNMEENDDEVGFGETDDRIAPSLPPPTPKEEDDPQ 755
            |.|.|.:..|| :...:.|.:                   |.|.....|.|.:         ||:
 Frog    81 PGGPYSVPGSTPYGNQQHGPY-------------------GQGAPTGNIPPGV---------DPE 117

  Fly   756 RIALRRLFDSVAGSDEEVDWQELKRILDHS-------MRDVMVGSD--GFSKDAVRSMVAMLDKD 811
            ..:..:..||                 |||       ::..:|.|:  .|:.:....|:.|.||.
 Frog   118 AFSWFQTVDS-----------------DHSGYISLKELKQALVNSNWSSFNDETCMMMMNMFDKS 165

  Fly   812 RSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRYGS 876
            .|||:....|.||...|.:||.:|:.||..|:|||:...|..||...||.|:.:.:..:..||..
 Frog   166 NSGRIDLFGFSALWRFIQQWRNLFQQYDRDRSGSINQGELHQALCQMGYQLSPQFVQLVMSRYAQ 230

  Fly   877 REGQ--IPFDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWLERT 922
            |..|  :..|.|:....::::..:.|||:||..|..|..:.:|:|..|
 Frog   231 RSVQPGLQLDRFIQICTQLQSMTQAFREKDTGLSGNAKLSYEDFLTMT 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpBNP_001246706.1 PD-C2-AF1 33..225 CDD:286403
Drf_FH1 37..189 CDD:283903
Peptidase_C2 260..556 CDD:279042
Calpain_III 574..721 CDD:279416 6/29 (21%)
EF-hand_7 759..825 CDD:290234 17/74 (23%)
EFh 761..826 CDD:298682 18/73 (25%)
FRQ1 827..>908 CDD:227455 27/82 (33%)
pef1XP_002938526.1 EFh_PEF_peflin 117..282 CDD:320059 50/179 (28%)
EF-hand motif 117..146 CDD:320059 6/45 (13%)
EF-hand motif 154..183 CDD:320059 10/28 (36%)
EF-hand motif 184..214 CDD:320059 12/29 (41%)
EF-hand motif 220..250 CDD:320059 6/29 (21%)
EF-hand motif 251..282 CDD:320059 10/28 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.