DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iPLA2-VIA and AT5G43590

DIOPT Version :9

Sequence 1:NP_729565.2 Gene:iPLA2-VIA / 39160 FlyBaseID:FBgn0036053 Length:887 Species:Drosophila melanogaster
Sequence 2:NP_001330015.1 Gene:AT5G43590 / 834379 AraportID:AT5G43590 Length:468 Species:Arabidopsis thaliana


Alignment Length:304 Identity:82/304 - (26%)
Similarity:127/304 - (41%) Gaps:82/304 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 LASGSQKSAVSSPEQLPSPTSPIAAEIGDKPYGRGRL---LCLDGGGIRGLV-------LVQMLL 581
            |:|....:..|..|:|......:..  .:||...|.|   |.|||||:||::       |.:.|.
plant    46 LSSNESYNQFSEKEELVIKDDSMFK--NNKPPKYGNLVTILSLDGGGVRGIIGGVILANLEKHLQ 108

  Fly   582 EIEKLSRTPIIHMFDWIAGTSTGGILALAL----GCGKTM---RQCMGLYLRMKEQCFVGS---- 635
            ||:......:...||.||||||||::...|    ..|:.:   :..:..||....:.|.||    
plant   109 EIDNDESVRLADYFDVIAGTSTGGLMTAMLTAPNDSGRPLYAAKDIVPFYLEESPKIFYGSKWWD 173

  Fly   636 --------RP-YNSEFFESILKDNLGEFNV---MTDIKHPKIMVTGVMADRKPVDLHLFRNYTSA 688
                    || ||.|:..:.|.:.|||..:   :|::..|..       |.|.:...:|.:|.::
plant   174 PSALWALFRPKYNGEYLHTRLGEILGETKLDQTLTNVVIPTF-------DIKKLQPTIFSSYHAS 231

  Fly   689 SDILGIVTPINNRRIPPPQPSEQLVWRAARATGAAPSY-----------FRAFGRFLDGGLIANN 742
            .|      |..|.::     |:..:     .|.|||.|           .|.| ..:|||:.||:
plant   232 VD------PSLNAKL-----SDICI-----GTSAAPFYLPPYKFPENDKMRTF-NLIDGGVTAND 279

  Fly   743 PTLDAMTEIHEYNMALRSAGRESEA---IPVS----VVMSLGTG 779
            |||..||.     |:.:|..:..:.   .|:.    :|:|:|||
plant   280 PTLVGMTA-----MSRKSIIKHPDMDGFKPLEYEKYIVISIGTG 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iPLA2-VIANP_729565.2 ANK repeat 166..226 CDD:293786
Ank_2 168..258 CDD:289560
ANK 191..343 CDD:238125
ANK repeat 228..261 CDD:293786
ANK 291..412 CDD:238125
ANK repeat 292..320 CDD:293786
Ank_2 297..386 CDD:289560
ANK repeat 322..353 CDD:293786
ANK repeat 355..386 CDD:293786
ANK repeat 388..417 CDD:293786
Pat_PNPLA9 563..876 CDD:132851 74/268 (28%)
AT5G43590NP_001330015.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.