DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iPLA2-VIA and Nfkbib

DIOPT Version :10

Sequence 1:NP_729565.2 Gene:iPLA2-VIA / 39160 FlyBaseID:FBgn0036053 Length:887 Species:Drosophila melanogaster
Sequence 2:NP_110494.2 Gene:Nfkbib / 81525 RGDID:621887 Length:359 Species:Rattus norvegicus


Alignment Length:314 Identity:73/314 - (23%)
Similarity:111/314 - (35%) Gaps:83/314 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 VFHYAASTTKEIINLII--------------DKSTVNLNHLNSDGYTPLHVACLADKPENVKALL 249
            ||.|........::|.:              ...|..|:..|..|.|.||:|.:..:...|:.|.
  Rat    50 VFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYLDLQNDLGQTALHLAAILGEASTVEKLY 114

  Fly   250 LAGANVNLNAKD----IRKVYKTSAPTTVSSFLR------TNVSKLY-TQDMKYGGTPLHWCSSR 303
            .|||.|.:..:.    :....:..|.|.....|:      .:.|..| ||...:  ||       
  Rat   115 AAGAGVLVTERGGHTALHLACRVRAHTCAYVLLQPRPSHPRDASDTYLTQSQDH--TP------- 170

  Fly   304 ETLHALIMEGCDVN-----------------ATNFDGRTALHVMVARNRFECVVTLLAHDAEIDV 351
            :|.||.:......|                 |.|:||.|.|||.|.....|.|  .|..||..| 
  Rat   171 DTSHAPVATDPQPNPGNEEELRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMV--QLLRDAGAD- 232

  Fly   352 LDKD----GNAALHIAIEKKLVPIVQCLVVFGCDINLKNKDGKTPRHMVGNDASGNKDDEILYIL 412
            |:|.    |...||:|:|.:...::..|:..|.|...:...|:||   :|: |....:..:..:|
  Rat   233 LNKPEPTCGRTPLHLAVEGQAAGVLALLLKAGADPTARMYGGRTP---LGS-ALLRPNPVLARLL 293

  Fly   413 HSVGAKRCKDTGSKCPPGCNAKGN-----------YNGI----------PPEAP 445
            .:.||...:|...|..|..|:..:           |:.|          ||.:|
  Rat   294 RAHGAPEPEDEDDKLSPCSNSSSDSDSDNRDEGDEYDDIVVHSRRSQNQPPPSP 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iPLA2-VIANP_729565.2 ANKYR 143..418 CDD:440430 63/264 (24%)
ANK repeat 166..226 CDD:293786 6/40 (15%)
ANK repeat 228..261 CDD:293786 11/32 (34%)
ANK repeat 292..320 CDD:293786 7/44 (16%)
ANK repeat 322..353 CDD:293786 13/30 (43%)
ANK repeat 355..386 CDD:293786 8/34 (24%)
ANK repeat 388..417 CDD:293786 6/28 (21%)
Pat_PNPLA9 563..876 CDD:132851
NfkbibNP_110494.2 ANKYR 56..310 CDD:440430 63/269 (23%)
ANK repeat 57..91 CDD:293786 3/33 (9%)
ANK 1 57..86 2/28 (7%)
ANK repeat 93..124 CDD:293786 11/30 (37%)
ANK 2 93..122 11/28 (39%)
ANK 3 126..155 3/28 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..192 10/47 (21%)
ANK repeat 206..237 CDD:293786 15/33 (45%)
ANK 4 206..235 14/31 (45%)
ANK repeat 239..271 CDD:293786 8/31 (26%)
ANK 5 240..269 8/28 (29%)
ANK 6 273..302 8/32 (25%)
ANK repeat 273..298 CDD:293786 6/28 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..359 10/50 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.