DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment iPLA2-VIA and Ankrd22

DIOPT Version :9

Sequence 1:	NP_729565.2	Gene:	iPLA2-VIA / 39160	FlyBaseID:	FBgn0036053	Length:	887	Species:	Drosophila melanogaster
Sequence 2:	NP_077166.4	Gene:	Ankrd22 / 52024	MGIID:	1277101	Length:	191	Species:	Mus musculus

Alignment Length:	138	Identity:	38/138 - (27%)
Similarity:	54/138 - (39%)	Gaps:	36/138 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly   288 QDMKYGGTPLHWCSSR----ETLHALIMEGCDVNATNFDGRTALHVMVARNRF------------ 336
            ||...|.||| .|:.|    ..:..|:....|||..|...||.||..| :.||
Mouse    35 QDSFNGDTPL-ICACRRGHLRIVSFLLRRNADVNLKNLKERTCLHYAV-KKRFTFFDYLLIILLM 97

  Fly   337 -----------------ECVVTLLAH-DAEIDVLDKDGNAALHIAIEKKLVPIVQCLVVFGCDIN 383
                             |.:|.:|.: ..|::..|.||..|||.|.:.|...::..|:....|..
Mouse    98 PVLLIGYFLMVSKTKQNETLVRMLLNAGVEVNATDCDGYTALHYACQMKNQTLIPLLLEAHADPM 162

  Fly   384 LKNKDGKT 391
            :|||.|::
Mouse   163 IKNKHGES 170

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
iPLA2-VIA	NP_729565.2	ANK repeat	166..226	CDD:293786
		Ank_2	168..258	CDD:289560
		ANK	191..343	CDD:238125	22/87 (25%)
		ANK repeat	228..261	CDD:293786
		ANK	291..412	CDD:238125	36/135 (27%)
		ANK repeat	292..320	CDD:293786	10/31 (32%)
		Ank_2	297..386	CDD:289560	29/122 (24%)
		ANK repeat	322..353	CDD:293786	11/60 (18%)
		ANK repeat	355..386	CDD:293786	9/30 (30%)
		ANK repeat	388..417	CDD:293786	1/4 (25%)
		Pat_PNPLA9	563..876	CDD:132851
Ankrd22	NP_077166.4	Ank_4	5..60	CDD:290365	8/25 (32%)
		ANK	39..187	CDD:238125	36/134 (27%)
		ANK repeat	39..70	CDD:293786	10/31 (32%)
		ANK 1	39..68		9/29 (31%)
		Ank_2	44..165	CDD:289560	29/122 (24%)
		ANK repeat	72..132	CDD:293786	11/60 (18%)
		ANK 2	72..100		7/28 (25%)
		ANK 3	101..130		4/28 (14%)
		ANK repeat	134..165	CDD:293786	9/30 (30%)
		ANK 4	134..163		9/28 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167846750
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930