DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iPLA2-VIA and Ankrd22

DIOPT Version :10

Sequence 1:NP_729565.2 Gene:iPLA2-VIA / 39160 FlyBaseID:FBgn0036053 Length:887 Species:Drosophila melanogaster
Sequence 2:NP_077166.4 Gene:Ankrd22 / 52024 MGIID:1277101 Length:191 Species:Mus musculus


Alignment Length:210 Identity:49/210 - (23%)
Similarity:69/210 - (32%) Gaps:75/210 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 PD--WEDFTGIVCLLLINATISFFEENNAGNAAAALMARLALKTRVLRDGQWQEQDASILVPGDI 161
            ||  |.| .|:||          ||.::....|.|..::.........||..:..|....|..::
Mouse   277 PDAEWGD-DGVVC----------FEPHSRAITALAFTSQPCNLITASYDGSARSMDLEKAVFDEV 330

  Fly   162 I----SIKLGDIIPADARLL-----EGDPLKIDQSVLTG---ESL--------------PV---- 196
            .    |:|..|.:.:|...|     .||...:|:.  ||   |||              ||    
Mouse   331 YRSSSSLKSFDFLSSDCSTLLFGEWNGDVAIVDRR--TGNSCESLHAMTAAPLRGVHVHPVQQHY 393

  Fly   197 ----------------TKKKGEQVFSGSTCK-QGEIEAVVIA-----TGS---TTFFGKTARLVD 236
                            .||:.    |.:.|: .|...:...|     |||   ||......|:.|
Mouse   394 FLVAESSFVNIYDLRHLKKRN----SPAVCELYGHSRSTSSAFFSPLTGSRVLTTCMDDCIRVFD 454

  Fly   237 STDVTGHFQQVLTSI 251
            |:.:.|.. ..||||
Mouse   455 SSQIAGSI-PALTSI 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iPLA2-VIANP_729565.2 ANKYR 143..418 CDD:440430 38/164 (23%)
ANK repeat 166..226 CDD:293786 22/110 (20%)
ANK repeat 228..261 CDD:293786 8/24 (33%)
ANK repeat 292..320 CDD:293786
ANK repeat 322..353 CDD:293786
ANK repeat 355..386 CDD:293786
ANK repeat 388..417 CDD:293786
Pat_PNPLA9 563..876 CDD:132851
Ankrd22NP_077166.4 ANKYR <8..190 CDD:440430
ANK repeat 39..70 CDD:293786
ANK 1 39..68
ANK repeat 72..132 CDD:293786
ANK 2 72..100
ANK 3 101..130
ANK repeat 134..165 CDD:293786
ANK 4 134..163
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.