DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iPLA2-VIA and PNPLA8

DIOPT Version :9

Sequence 1:NP_729565.2 Gene:iPLA2-VIA / 39160 FlyBaseID:FBgn0036053 Length:887 Species:Drosophila melanogaster
Sequence 2:XP_011514576.1 Gene:PNPLA8 / 50640 HGNCID:28900 Length:810 Species:Homo sapiens


Alignment Length:554 Identity:134/554 - (24%)
Similarity:216/554 - (38%) Gaps:179/554 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 PEAPESVEQREHIEHMLATTSRQMMGGFLNAAANGIL-----------------------EKQQP 483
            |.:|.:      |..:|..:::|.:..||:....|:.                       |:::|
Human   297 PTSPSA------IPDVLQVSTKQSIANFLSRPTEGVQALVGGYIGGLVPKLKYDSKSQSEEQEEP 355

  Fly   484 AQKPVVVDTEKELKGQSIMDALLGMFTTKVNADEMKK--------------ENSSDSLASGSQKS 534
            |:....|..::                   ||:|.|:              :|.:.:|....:::
Human   356 AKTDQAVSKDR-------------------NAEEKKRLSLQREKIIARVSIDNRTRALVQALRRT 401

  Fly   535 --------------------------AVS-------------SPEQLPSPTSPIAAEIG--DKPY 558
                                      ||.             ..|.|.:....|.|.||  |...
Human   402 TDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPYLLRLRQIKDETLQAAVREILALIGYVDPVK 466

  Fly   559 GRG-RLLCLDGGGIRGLVLVQMLLEIEKLSRTPIIHMFDWIAGTSTGGILALALGC-GKTMRQCM 621
            ||| |:|.:||||.||:|.:|.|.::.:|::.|:..:||:|.|.|||.|||..||. ...:.:|.
Human   467 GRGIRILSIDGGGTRGVVALQTLRKLVELTQKPVHQLFDYICGVSTGAILAFMLGLFHMPLDECE 531

  Fly   622 GLYLRMKEQCF-----VGSRP-------YNSEFFESILKDNLGEFNVMTDIKH---PKIMVTGVM 671
            .||.::....|     ||:..       |:|:.:|:||||.:|...::...::   ||:.....:
Human   532 ELYRKLGSDVFSQNVIVGTVKMSWSHAFYDSQTWENILKDRMGSALMIETARNPTCPKVAAVSTI 596

  Fly   672 ADR--KPVDLHLFRNYTSASDILGIVTPINNRRIPPPQPSEQLVWRAARATGAAPSYFR--AFGR 732
            .:|  .| ...:||||       |....||:..:...|   ..:|:|.||:.|||.||.  |.|.
Human   597 VNRGITP-KAFVFRNY-------GHFPGINSHYLGGCQ---YKMWQAIRASSAAPGYFAEYALGN 650

  Fly   733 FL--DGGLIANNPTLDAMTEIHEYNMALRSAGRESEAIPVSVVMSLGTGH--------IPVTELK 787
            .|  ||||:.|||:..||   ||.......       :|:..::|||||.        :..|.||
Human   651 DLHQDGGLLLNNPSALAM---HECKCLWPD-------VPLECIVSLGTGRYESDVRNTVTYTSLK 705

  Fly   788 DIDVFRPESIWDTAKLAYGISTIGNLLVDQATCSDGRVVDRARAWCSTIGIPYFRFNPQLSEDIA 852
            ........|..||.::        ::::|.....|                .||||||.:.|:|.
Human   706 TKLSNVINSATDTEEV--------HIMLDGLLPPD----------------TYFRFNPVMCENIP 746

  Fly   853 MDEKDDQKLINMLWHTKAYMHANRNKIIEMINFL 886
            :||..::||..:......|:..|..|:.::...|
Human   747 LDESRNEKLDQLQLEGLKYIERNEQKMKKVAKIL 780

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iPLA2-VIANP_729565.2 ANK repeat 166..226 CDD:293786
Ank_2 168..258 CDD:289560
ANK 191..343 CDD:238125
ANK repeat 228..261 CDD:293786
ANK 291..412 CDD:238125
ANK repeat 292..320 CDD:293786
Ank_2 297..386 CDD:289560
ANK repeat 322..353 CDD:293786
ANK repeat 355..386 CDD:293786
ANK repeat 388..417 CDD:293786
Pat_PNPLA9 563..876 CDD:132851 100/342 (29%)
PNPLA8XP_011514576.1 Pat_PNPLA8 463..769 CDD:132850 105/350 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.