Sequence 1: | NP_729565.2 | Gene: | iPLA2-VIA / 39160 | FlyBaseID: | FBgn0036053 | Length: | 887 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_955923.1 | Gene: | nfkbiab / 323099 | ZFINID: | ZDB-GENE-030131-1819 | Length: | 312 | Species: | Danio rerio |
Alignment Length: | 239 | Identity: | 54/239 - (22%) |
---|---|---|---|
Similarity: | 102/239 - (42%) | Gaps: | 45/239 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 198 SVFHYAASTTKEIINLIIDKSTVNLNHLNSDGYTPLHVACLADKPENVKALLLAGANVNLNAKDI 262
Fly 263 RKVYKTSAPTTVSSFLRTNVSKLYTQDMKYGGTPLHWCSSRETL--HALIMEGCD------VNAT 319
Fly 320 NFDGRTALHVMVARNRFECVVTLLAHDAEIDVLDK-DGNAALHIAIEKKLVPIVQCLVVFGCDIN 383
Fly 384 LKNKDGKTPRHMVGNDASGNKD-DEILYILHSVGAKRCKDTGSK 426 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
iPLA2-VIA | NP_729565.2 | ANK repeat | 166..226 | CDD:293786 | 6/27 (22%) |
Ank_2 | 168..258 | CDD:289560 | 18/59 (31%) | ||
ANK | 191..343 | CDD:238125 | 32/152 (21%) | ||
ANK repeat | 228..261 | CDD:293786 | 12/32 (38%) | ||
ANK | 291..412 | CDD:238125 | 31/130 (24%) | ||
ANK repeat | 292..320 | CDD:293786 | 8/35 (23%) | ||
Ank_2 | 297..386 | CDD:289560 | 21/97 (22%) | ||
ANK repeat | 322..353 | CDD:293786 | 6/30 (20%) | ||
ANK repeat | 355..386 | CDD:293786 | 8/30 (27%) | ||
ANK repeat | 388..417 | CDD:293786 | 10/29 (34%) | ||
Pat_PNPLA9 | 563..876 | CDD:132851 | |||
nfkbiab | NP_955923.1 | Ank_2 | <68..139 | CDD:289560 | 19/89 (21%) |
ANK repeat | 72..106 | CDD:293786 | 6/27 (22%) | ||
ANK | 103..234 | CDD:238125 | 36/161 (22%) | ||
ANK repeat | 110..139 | CDD:293786 | 12/57 (21%) | ||
Ank_2 | 113..241 | CDD:289560 | 35/158 (22%) | ||
ANK repeat | 141..210 | CDD:293786 | 15/68 (22%) | ||
Ank_5 | 167..221 | CDD:290568 | 11/53 (21%) | ||
ANK repeat | 213..241 | CDD:293786 | 8/27 (30%) | ||
Ank_2 | 218..>268 | CDD:289560 | 13/51 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170591957 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |