DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iPLA2-VIA and Ankrd22

DIOPT Version :10

Sequence 1:NP_729565.2 Gene:iPLA2-VIA / 39160 FlyBaseID:FBgn0036053 Length:887 Species:Drosophila melanogaster
Sequence 2:NP_001178567.1 Gene:Ankrd22 / 294093 RGDID:1307862 Length:191 Species:Rattus norvegicus


Alignment Length:138 Identity:37/138 - (26%)
Similarity:53/138 - (38%) Gaps:36/138 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 QDMKYGGTPLHWCSSR----ETLHALIMEGCDVNATNFDGRTALHVMVARNRF------------ 336
            ||...|.||| .|:.|    ..:..|:....|||..|...||.||..| :.||            
  Rat    35 QDGFNGDTPL-ICACRRGHLRIVSFLLRRNADVNLKNLKERTCLHYAV-KKRFTFFDYLLIILLM 97

  Fly   337 -----------------ECVVTLLAH-DAEIDVLDKDGNAALHIAIEKKLVPIVQCLVVFGCDIN 383
                             |.:|.:|.: ..|::..|..|..|||.|.:.|...::..|:....|..
  Rat    98 PVLLIGYFLMVSKTKQNEALVRMLLNAGVEVNATDCYGYTALHYACQMKNQTLIPLLLAARADPT 162

  Fly   384 LKNKDGKT 391
            :|||.|::
  Rat   163 IKNKHGES 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iPLA2-VIANP_729565.2 ANKYR 143..418 CDD:440430 37/138 (27%)
ANK repeat 166..226 CDD:293786
ANK repeat 228..261 CDD:293786
ANK repeat 292..320 CDD:293786 10/31 (32%)
ANK repeat 322..353 CDD:293786 11/60 (18%)
ANK repeat 355..386 CDD:293786 8/30 (27%)
ANK repeat 388..417 CDD:293786 1/4 (25%)
Pat_PNPLA9 563..876 CDD:132851
Ankrd22NP_001178567.1 ANKYR <8..189 CDD:440430 37/138 (27%)
ANK repeat 39..70 CDD:293786 10/31 (32%)
ANK repeat 72..132 CDD:293786 11/60 (18%)
ANK repeat 134..165 CDD:293786 8/30 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.