Sequence 1: | NP_729565.2 | Gene: | iPLA2-VIA / 39160 | FlyBaseID: | FBgn0036053 | Length: | 887 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001099190.2 | Gene: | Nfkbia / 25493 | RGDID: | 3171 | Length: | 314 | Species: | Rattus norvegicus |
Alignment Length: | 205 | Identity: | 51/205 - (24%) |
---|---|---|---|
Similarity: | 86/205 - (41%) | Gaps: | 42/205 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 198 SVFHYAASTTKEIINLIIDKSTVNLNHLNSDGYTPLHVACLADKPENVKALLLAGANVNLNAKDI 262
Fly 263 RKVYKTSAPTTVSSFLRTNVSKLYTQDMKYGGTPLHWCSSRETLH--ALIMEGCD-------VNA 318
Fly 319 TNFDGRTALHVMVARNRFECVVTLLAHDAEIDVLDK-DGNAALHIAIEKKLVPIVQCLVVFGCDI 382
Fly 383 NLKNKDGKTP 392 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
iPLA2-VIA | NP_729565.2 | ANK repeat | 166..226 | CDD:293786 | 6/27 (22%) |
Ank_2 | 168..258 | CDD:289560 | 18/59 (31%) | ||
ANK | 191..343 | CDD:238125 | 37/153 (24%) | ||
ANK repeat | 228..261 | CDD:293786 | 12/32 (38%) | ||
ANK | 291..412 | CDD:238125 | 30/112 (27%) | ||
ANK repeat | 292..320 | CDD:293786 | 9/36 (25%) | ||
Ank_2 | 297..386 | CDD:289560 | 25/98 (26%) | ||
ANK repeat | 322..353 | CDD:293786 | 7/30 (23%) | ||
ANK repeat | 355..386 | CDD:293786 | 10/30 (33%) | ||
ANK repeat | 388..417 | CDD:293786 | 2/5 (40%) | ||
Pat_PNPLA9 | 563..876 | CDD:132851 | |||
Nfkbia | NP_001099190.2 | ANK repeat | 143..180 | CDD:293786 | 10/65 (15%) |
ANK 2 | 143..172 | 9/57 (16%) | |||
ANK repeat | 182..213 | CDD:293786 | 7/30 (23%) | ||
ANK 3 | 182..211 | 7/28 (25%) | |||
Ank_5 | 202..256 | CDD:290568 | 14/52 (27%) | ||
ANK repeat | 216..246 | CDD:293786 | 10/29 (34%) | ||
ANK 4 | 216..245 | 9/28 (32%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..39 | ||||
Destruction motif. /evidence=ECO:0000250 | 30..36 | ||||
Nuclear export signal. /evidence=ECO:0000250 | 45..54 | ||||
ANK repeat | 73..108 | CDD:293786 | 6/27 (22%) | ||
ANK | 105..237 | CDD:238125 | 40/162 (25%) | ||
ANK repeat | 110..141 | CDD:293786 | 12/32 (38%) | ||
ANK 1 | 110..139 | 11/28 (39%) | |||
Nuclear import signal. /evidence=ECO:0000250 | 110..120 | 5/9 (56%) | |||
Ank_2 | 115..212 | CDD:289560 | 30/127 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166350284 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |