DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iPLA2-VIA and Nfkbib

DIOPT Version :9

Sequence 1:NP_729565.2 Gene:iPLA2-VIA / 39160 FlyBaseID:FBgn0036053 Length:887 Species:Drosophila melanogaster
Sequence 2:NP_001293151.1 Gene:Nfkbib / 18036 MGIID:104752 Length:359 Species:Mus musculus


Alignment Length:341 Identity:79/341 - (23%)
Similarity:122/341 - (35%) Gaps:83/341 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 VFHYAASTTKEIINLII--------------DKSTVNLNHLNSDGYTPLHVACLADKPENVKALL 249
            ||.|........::|.:              ...|..|:..|..|.|.||:|.:..:...|:.|.
Mouse    50 VFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYLDLQNDLGQTALHLAAILGEASTVEKLY 114

  Fly   250 LAGANVNLNAKD----IRKVYKTSAPTTVSSFLR------TNVSKLY---TQDMKYGGTPLHWCS 301
            .|||.|.:..:.    :....:..|.|.....|:      .:.|..|   :||.    ||     
Mouse   115 AAGAGVLVAERGGHTALHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDC----TP----- 170

  Fly   302 SRETLHALIMEGCDVN-----------------ATNFDGRTALHVMVARNRFECVVTLLAHDAEI 349
              :|.||........|                 |.|:||.|.|||.|.....|.|  .|..||..
Mouse   171 --DTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMV--RLLRDAGA 231

  Fly   350 DVLDKD----GNAALHIAIEKKLVPIVQCLVVFGCDINLKNKDGKTPRHMVGNDASGNKDDEILY 410
            | |:|.    |...||:|:|.:...:::.|:..|.|...:...|:||   :|: |....:..:..
Mouse   232 D-LNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTP---LGS-ALLRPNPILAR 291

  Fly   411 ILHSVGAKRCKDTGSKCPPGCNAKGNYNGIPPEAPESVEQREHIEHMLATTSRQMMGGFLNAAAN 475
            :|.:.||...:|...|..| |::.|: :.......|..|..:.:.|...:.:||           
Mouse   292 LLRAHGAPEPEDEDDKLSP-CSSSGS-DSDSDNRDEGDEYDDIVVHSGRSQNRQ----------- 343

  Fly   476 GILEKQQPAQKPVVVD 491
                ...||.||:..|
Mouse   344 ----PPSPASKPLPDD 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iPLA2-VIANP_729565.2 ANK repeat 166..226 CDD:293786 6/40 (15%)
Ank_2 168..258 CDD:289560 18/72 (25%)
ANK 191..343 CDD:238125 42/187 (22%)
ANK repeat 228..261 CDD:293786 11/32 (34%)
ANK 291..412 CDD:238125 36/141 (26%)
ANK repeat 292..320 CDD:293786 7/44 (16%)
Ank_2 297..386 CDD:289560 29/109 (27%)
ANK repeat 322..353 CDD:293786 13/30 (43%)
ANK repeat 355..386 CDD:293786 8/34 (24%)
ANK repeat 388..417 CDD:293786 6/28 (21%)
Pat_PNPLA9 563..876 CDD:132851
NfkbibNP_001293151.1 ANK 53..226 CDD:238125 40/185 (22%)
ANK repeat 57..91 CDD:293786 3/33 (9%)
ANK 1 57..86 2/28 (7%)
Ank_4 58..113 CDD:290365 10/54 (19%)
ANK repeat 93..124 CDD:293786 11/30 (37%)
ANK 2 93..122 11/28 (39%)
Ank_2 98..234 CDD:289560 37/149 (25%)
ANK 3 126..155 3/28 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..194 10/51 (20%)
ANK 202..>298 CDD:238125 31/102 (30%)
ANK repeat 206..237 CDD:293786 15/33 (45%)
ANK 4 206..235 14/31 (45%)
Ank_2 211..298 CDD:289560 26/93 (28%)
ANK repeat 239..271 CDD:293786 8/31 (26%)
ANK 5 240..269 8/28 (29%)
ANK 6 273..302 8/32 (25%)
ANK repeat 273..298 CDD:293786 6/28 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..359 16/75 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846745
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.