DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iPLA2-VIA and Nfkbia

DIOPT Version :9

Sequence 1:NP_729565.2 Gene:iPLA2-VIA / 39160 FlyBaseID:FBgn0036053 Length:887 Species:Drosophila melanogaster
Sequence 2:NP_035037.2 Gene:Nfkbia / 18035 MGIID:104741 Length:314 Species:Mus musculus


Alignment Length:205 Identity:51/205 - (24%)
Similarity:85/205 - (41%) Gaps:42/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 SVFHYAASTTKEIINLIIDKSTVNLNHLNSDGYTPLHVACLADKPENVKALLLAGANVNLNAKDI 262
            ::.|.....|.|:|.. :......||..|:...||||:|.:.::|...:|||.||.:..|  :|.
Mouse    81 AIIHEEKPLTMEVIGQ-VKGDLAFLNFQNNLQQTPLHLAVITNQPGIAEALLKAGCDPEL--RDF 142

  Fly   263 RKVYKTSAPTTVSSFLRTNVSKLYTQDMKYGGTPLHWCSSRETLH--ALIMEGCD-------VNA 318
            |                             |.||||....:..|.  |::.:.|.       :.|
Mouse   143 R-----------------------------GNTPLHLACEQGCLASVAVLTQTCTPQHLHSVLQA 178

  Fly   319 TNFDGRTALHVMVARNRFECVVTLLAHDAEIDVLDK-DGNAALHIAIEKKLVPIVQCLVVFGCDI 382
            ||::|.|.||:.........|..|:...|:::..:. :|..|||:|::.:...:|..|:..|.|:
Mouse   179 TNYNGHTCLHLASIHGYLAIVEHLVTLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADV 243

  Fly   383 NLKNKDGKTP 392
            |.....|.:|
Mouse   244 NRVTYQGYSP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iPLA2-VIANP_729565.2 ANK repeat 166..226 CDD:293786 6/27 (22%)
Ank_2 168..258 CDD:289560 18/59 (31%)
ANK 191..343 CDD:238125 37/153 (24%)
ANK repeat 228..261 CDD:293786 12/32 (38%)
ANK 291..412 CDD:238125 30/112 (27%)
ANK repeat 292..320 CDD:293786 9/36 (25%)
Ank_2 297..386 CDD:289560 25/98 (26%)
ANK repeat 322..353 CDD:293786 7/30 (23%)
ANK repeat 355..386 CDD:293786 10/30 (33%)
ANK repeat 388..417 CDD:293786 2/5 (40%)
Pat_PNPLA9 563..876 CDD:132851
NfkbiaNP_035037.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
Ank_2 <26..>151 CDD:330894 26/101 (26%)
Destruction motif 30..36
Nuclear export signal. /evidence=ECO:0000250 45..54
ANK repeat 73..108 CDD:293786 6/27 (22%)
ANK 1 73..103 4/22 (18%)
ANK 105..237 CDD:238125 40/162 (25%)
ANK repeat 110..141 CDD:293786 12/32 (38%)
ANK 2 110..139 11/28 (39%)
Nuclear import signal. /evidence=ECO:0000250 110..120 5/9 (56%)
ANK repeat 143..180 CDD:293786 10/65 (15%)
ANK 3 143..172 9/57 (16%)
ANK repeat 182..213 CDD:293786 7/30 (23%)
ANK 4 182..211 7/28 (25%)
ANK repeat 216..246 CDD:293786 10/29 (34%)
ANK 5 216..245 9/28 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846752
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.