DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and AT5G12320

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_568265.2 Gene:AT5G12320 / 831107 AraportID:AT5G12320 Length:144 Species:Arabidopsis thaliana


Alignment Length:107 Identity:33/107 - (30%)
Similarity:57/107 - (53%) Gaps:4/107 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 LRTAASTCNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLLKYGANPNVVDSLGNT 231
            |..||...:|:.|..:...|.:.::.|...|:.||:||..|::.||:.|:..|.:.|.::...|.
plant    15 LLEAARYNDIDDLRTLASDGLSLHSRDSQGRTALHMAAANGHMTIVEYLISEGVDINALNDENNA 79

  Fly   232 PLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLELA 273
            |||.|.:    |....||..|:..|||:.:.:|..::|::.|
plant    80 PLHWACL----NGHVEVVKRLILAGASLSLLNRYERTPMDEA 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 30/95 (32%)
ANK repeat 167..193 CDD:293786 6/25 (24%)
ANK 170..276 CDD:238125 32/104 (31%)
ANK repeat 195..226 CDD:293786 11/30 (37%)
ANK repeat 228..263 CDD:293786 12/34 (35%)
AT5G12320NP_568265.2 Ank_2 15..107 CDD:403870 30/95 (32%)
ANK repeat 15..41 CDD:293786 6/25 (24%)
ANK repeat 43..74 CDD:293786 11/30 (37%)
ANK repeat 76..107 CDD:293786 12/34 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1559479at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.