DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and AKR2B

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_179331.1 Gene:AKR2B / 816246 AraportID:AT2G17390 Length:344 Species:Arabidopsis thaliana


Alignment Length:330 Identity:79/330 - (23%)
Similarity:124/330 - (37%) Gaps:91/330 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NDSSGVESAKEEVEMSMPPSPMSMAMVLAKSTPMPMPTSASKG----------------IMITPP 55
            ||.|..|.|:   :::..||...:|..|.:|    :||.:.:|                :|..|.
plant    61 NDPSIKELAE---QIAKDPSFNQLAEQLQRS----VPTGSHEGGLPNFDPQQYMQTMQQVMENPE 118

  Fly    56 --------PPAMPPTPTSSPNTHGEWPHMNINLNLNMSSNPSTNASF-----QLSRDRGEHFALP 107
                    ..|:...|..||             .|....||:.:..|     |:..|       |
plant   119 FRTMAERLGNALVQDPQMSP-------------FLEALGNPAASEQFAERMAQMKED-------P 163

  Fly   108 HLPPLPL-----NPNA-----SNAEYLPSLIHPSTLPSGS-KSFKMRPRMQRLKHSYSYSNIIVQ 161
            .|.|:..     .|:|     ::.:.|..|.....:..|: ::....|  :..:......:|:.|
plant   164 ELKPILAEIDAGGPSAMMKYWNDKDVLAKLGEAMGIAVGADQTVAAEP--EEAEEGEEEESIVHQ 226

  Fly   162 SNGRKLRTAASTCNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLLKYGANPNVVD 226
            :        ||..::|.|...|..|.|.:..|...|:.||.|...|.:...|.||..|||.|.:|
plant   227 T--------ASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGEVRCAQVLLDAGANANAID 283

  Fly   227 SLGNTPLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLELAEAKLRLLRNRYDHPTPET 291
            ...|||||.    |:.......|.:||:.||:|...:..||:|:::|.     |.|:.|     .
plant   284 KNKNTPLHY----AAGYGRKECVSLLLENGAAVTQQNMDNKNPIDVAR-----LNNQLD-----V 334

  Fly   292 AKILE 296
            .|:||
plant   335 VKLLE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 33/95 (35%)
ANK repeat 167..193 CDD:293786 7/25 (28%)
ANK 170..276 CDD:238125 37/105 (35%)
ANK repeat 195..226 CDD:293786 12/30 (40%)
ANK repeat 228..263 CDD:293786 12/34 (35%)
AKR2BNP_179331.1 EBP50_C <2..>49 CDD:286142
ANK 225..338 CDD:238125 42/134 (31%)
Ank_2 225..316 CDD:289560 34/102 (33%)
ANK repeat 252..283 CDD:293786 12/30 (40%)
ANK repeat 285..316 CDD:293786 12/34 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.