DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and Asb8

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001164181.1 Gene:Asb8 / 78541 MGIID:1925791 Length:288 Species:Mus musculus


Alignment Length:245 Identity:66/245 - (26%)
Similarity:98/245 - (40%) Gaps:78/245 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 MQRLKHSYSYSNIIVQ-------------------------SNG--RKLRTAASTCNIELLNRIL 183
            ||.::..||.|..:::                         ::|  :.|..|....:.:.:..:|
Mouse     9 MQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCTHGTLKPLHCACMVSDADCVELLL 73

  Fly   184 EGGANPNAADEYNRSPLHLA-----ACRGYIPIVQQLLKYGANPNVVDSLGNTPLHLAVISASSN 243
            |.||..||.|.|||:.||.|     ||      |:.||:||||||.:|...:||||.|   |..|
Mouse    74 EKGAEVNALDGYNRTALHYAAEKDEAC------VEVLLEYGANPNALDGNRDTPLHWA---AFKN 129

  Fly   244 NFNVVVGVLLQGGASVHMYDRSNKSPLELAE---------------AKLRLLRNRYDHPTPETAK 293
            |.. .|..||:.||||:..|.:|.:||..|.               |::|::..:...|......
Mouse   130 NAE-CVRALLESGASVNALDYNNDTPLSWAAMKGNLESVSILLDYGAEVRVINLKGQTPISRLVA 193

  Fly   294 IL--------EDMCM-------------LTTLILRYMVKQQRELEDLSAL 322
            :|        ||.|.             ...::.|.:.|.|:..|.|:.|
Mouse   194 LLVRGLGTEKEDSCFELLHRAVGQFELRKNGIMPREVTKDQQLCEKLTVL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 42/100 (42%)
ANK repeat 167..193 CDD:293786 8/25 (32%)
ANK 170..276 CDD:238125 46/125 (37%)
ANK repeat 195..226 CDD:293786 17/35 (49%)
ANK repeat 228..263 CDD:293786 15/34 (44%)
Asb8NP_001164181.1 PHA02876 <26..>215 CDD:165207 55/198 (28%)
ANK 1 52..81 7/28 (25%)
ANK repeat 56..83 CDD:293786 8/26 (31%)
ANK repeat 85..115 CDD:293786 17/35 (49%)
ANK 2 85..113 16/33 (48%)
ANK repeat 117..148 CDD:293786 15/34 (44%)
ANK 3 117..146 15/32 (47%)
ANK repeat 150..181 CDD:293786 6/30 (20%)
ANK 4 150..179 5/28 (18%)
SOCS_ASB8 245..287 CDD:239697
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.