DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10809 and ANKRD50

DIOPT Version :9

Sequence 1:	NP_001163403.1	Gene:	CG10809 / 39159	FlyBaseID:	FBgn0036052	Length:	358	Species:	Drosophila melanogaster
Sequence 2:	NP_065070.1	Gene:	ANKRD50 / 57182	HGNCID:	29223	Length:	1429	Species:	Homo sapiens

Alignment Length:	136	Identity:	38/136 - (27%)
Similarity:	70/136 - (51%)	Gaps:	12/136 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   163 NGRKLRTAASTC------NIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLLKYGAN 221
            :||...:.|:.|      :..:::.:::.||..:..|:...:||.:||..|::.:|..||:.||:
Human   709 DGRTALSVAALCVPASKGHASVVSLLIDRGAEVDHCDKDGMTPLLVAAYEGHVDVVDLLLEGGAD 773

  Fly   222 PNVVDSLGNTPLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLELAEAK--LRLLRNRY 284
            .:..|:.|.|||    ::|:|.....||..||..||:|...|...::.|.:|.|:  :.::|...
Human   774 VDHTDNNGRTPL----LAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLL 834

  Fly   285 DHPTPE 290
            |....|
Human   835 DRGLDE 840

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10809	NP_001163403.1	Ank_2	167..263	CDD:289560	29/101 (29%)
		ANK repeat	167..193	CDD:293786	4/31 (13%)
		ANK	170..276	CDD:238125	32/111 (29%)
		ANK repeat	195..226	CDD:293786	10/30 (33%)
		ANK repeat	228..263	CDD:293786	13/34 (38%)
ANKRD50	NP_065070.1	AAA_16	22..195	CDD:289934
		Cas9_REC	<221..>352	CDD:293200
		ANK 1	477..509
		ANK	<495..598	CDD:238125
		ANK 2	511..540
		Ank_5	531..585	CDD:290568
		ANK repeat	544..575	CDD:293786
		ANK 3	544..573
		ANK	573..697	CDD:238125
		ANK repeat	577..608	CDD:293786
		ANK 4	577..606
		Ank_2	582..674	CDD:289560
		ANK repeat	610..641	CDD:293786
		ANK 5	610..639
		ANK repeat	643..674	CDD:293786
		ANK 6	643..672
		Ank_2	648..745	CDD:289560	6/35 (17%)
		ANK repeat	676..707	CDD:293786
		ANK 7	676..705
		ANK repeat	709..745	CDD:293786	6/35 (17%)
		ANK 8	709..743		6/33 (18%)
		ANK	742..867	CDD:238125	32/103 (31%)
		ANK repeat	747..778	CDD:293786	10/30 (33%)
		ANK 9	747..776		10/28 (36%)
		Ank_2	752..844	CDD:289560	30/93 (32%)
		ANK repeat	780..811	CDD:293786	13/34 (38%)
		ANK 10	780..809		13/32 (41%)
		ANK	808..932	CDD:238125	7/33 (21%)
		ANK repeat	813..844	CDD:293786	6/28 (21%)
		ANK 11	813..842		6/28 (21%)
		ANK 12	846..875
		ANK repeat	847..877	CDD:293786
		Ank_2	851..943	CDD:289560
		ANK repeat	879..910	CDD:293786
		ANK 13	879..908
		ANK repeat	912..943	CDD:293786
		ANK 14	912..941
		ANK repeat	945..976	CDD:293786
		ANK 15	945..974
		Ank_4	946..999	CDD:290365
		ANK	974..1097	CDD:238125
		ANK repeat	978..1009	CDD:293786
		ANK 16	978..1007
		Ank_2	983..1075	CDD:289560
		ANK repeat	1011..1042	CDD:293786
		ANK 17	1011..1040
		ANK repeat	1044..1075	CDD:293786
		ANK 18	1044..1073
		Ank_2	1049..>1110	CDD:289560
		ANK 19	1077..1107
		ANK repeat	1077..1102	CDD:293786
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1108..1200
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1217..1296
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910