DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and caiap

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001020663.1 Gene:caiap / 557416 ZFINID:ZDB-GENE-041014-19 Length:744 Species:Danio rerio


Alignment Length:298 Identity:65/298 - (21%)
Similarity:103/298 - (34%) Gaps:83/298 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SAKEEVEMSMPPSPMSMAMVLAKSTPMPMPTSASKGIMITPPPPAMPP---TPTSSPNTHGEWPH 75
            |.|.:::..:|....|:.:.:...:.........|||    .|....|   ||.....:|.:...
Zfish   432 SKKAKLDERLPNQMSSLHLAVQSGSIQIAQILLHKGI----DPNISGPKDQTPLHLSASHNQPAM 492

  Fly    76 MNINLNLNMSSNPSTNASFQLSRDRGEHFALPHLPPLPLNPNASNAEYLPSLIHPSTLPSGSKSF 140
            |.:.|.:....||.|...|               .||.|.....:.|.:..|:.           
Zfish   493 MALLLRVGAQLNPVTQDGF---------------TPLHLASQNGHTEAVAQLLE----------- 531

  Fly   141 KMRPRMQRLKHSYSYSNIIVQSNGRKLRT----AASTCNIELLNRILEGGANPNAADEYNRSPLH 201
                           :...|.:..::.||    ||....:.::..:|..||..||::...::|||
Zfish   532 ---------------AKADVHAKDKQGRTALHWAAEQGEVAIIQSLLAAGAYSNASEREKKTPLH 581

  Fly   202 LAACRGYIPIVQQLLKYGANPNVVDSLGNTPLHLA----------VISASSNNFNV--------- 247
            |||..|:...|..||...|.....|..|.:|||.|          |:.|||.:.||         
Zfish   582 LAAAEGHTKAVSALLAGKAKVGAKDMDGCSPLHYAARNGKERAGSVLLASSKSKNVDDKNVWRRT 646

  Fly   248 ------------VVGVLLQGGASVHMYDRSNKSPLELA 273
                        :||:||:..|.::..|.:..:||..|
Zfish   647 ALHLAAEHGHEALVGILLENKAKINALDNNKDTPLHCA 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 37/130 (28%)
ANK repeat 167..193 CDD:293786 9/29 (31%)
ANK 170..276 CDD:238125 39/135 (29%)
ANK repeat 195..226 CDD:293786 11/30 (37%)
ANK repeat 228..263 CDD:293786 16/65 (25%)
caiapNP_001020663.1 CARD 15..94 CDD:260018
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..146
ANK 1. /evidence=ECO:0000255 157..185
ANK repeat 159..187 CDD:293786
PHA03095 160..>577 CDD:222980 33/189 (17%)
ANK 2. /evidence=ECO:0000255 189..218
ANK repeat 191..220 CDD:293786
ANK repeat 222..253 CDD:293786
ANK 3. /evidence=ECO:0000255 222..251
ANK 4. /evidence=ECO:0000255 255..285
ANK 5. /evidence=ECO:0000255 287..314
ANK repeat 318..348 CDD:293786
ANK 6. /evidence=ECO:0000255 318..347
ANK 7. /evidence=ECO:0000255 377..406
ANK repeat 379..408 CDD:293786
ANK repeat 410..441 CDD:293786 2/8 (25%)
ANK 8. /evidence=ECO:0000255 410..439 2/6 (33%)
ANK 9. /evidence=ECO:0000255 443..472 5/32 (16%)
ANK repeat 446..474 CDD:293786 5/31 (16%)
PHA03095 463..>698 CDD:222980 61/267 (23%)
ANK 10. /evidence=ECO:0000255 476..505 5/28 (18%)
ANK repeat 478..507 CDD:293786 7/28 (25%)
ANK repeat 509..540 CDD:293786 7/71 (10%)
ANK 11. /evidence=ECO:0000255 509..538 7/69 (10%)
ANK repeat 542..573 CDD:293786 9/30 (30%)
ANK 12. /evidence=ECO:0000255 542..571 7/28 (25%)
ANK repeat 575..606 CDD:293786 11/30 (37%)
ANK 13. /evidence=ECO:0000255 575..604 11/28 (39%)
ANK repeat 608..639 CDD:293786 11/30 (37%)
ANK 14. /evidence=ECO:0000255 608..637 9/28 (32%)
ANK repeat 641..674 CDD:293786 5/32 (16%)
ANK 15. /evidence=ECO:0000255 643..672 5/28 (18%)
ANK repeat 676..711 CDD:293786 3/9 (33%)
ANK 16. /evidence=ECO:0000255 676..705 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.