DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and Ilk

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster


Alignment Length:220 Identity:57/220 - (25%)
Similarity:100/220 - (45%) Gaps:42/220 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 SFKMRPRMQRLKHSYSYSNIIVQSNG-RKLRTAASTCNIELLNRILEGGANPNAADEYNRSPLHL 202
            |.::|..:...:|    .|.:...:| ..|...|...:.:|:..:|:.|:..||.:..:..||||
  Fly    13 SIQVRLWLDETEH----DNNLGDDHGFSPLHWVAKEGHAKLVETLLQRGSRVNATNMGDDIPLHL 73

  Fly   203 AACRGYIPIVQQLLKYGANPNVVDSLGNTPLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNK 267
            ||..|:..:||.|:|..::.|.|:..||||||.|...    .::::...||..||.|.:.::...
  Fly    74 AAAHGHRDVVQMLIKERSDVNAVNEHGNTPLHYACFW----GYDMICEDLLNAGAQVGIANKDGH 134

  Fly   268 SPLELAEAKLRLLRNRYDHPTPETAKILEDMCMLTTLILRYMVKQQRELEDLSALEKRLQNLSTS 332
            :|||.|:              |..||.|:|:          :.|..||::.:|..|:..|.|.| 
  Fly   135 TPLEKAK--------------PSLAKRLQDL----------VEKSGREVKVISFKEQSWQGLKT- 174

  Fly   333 DDQEQVVSQTADELLASVERLSINN 357
                    ::.|..|:..:.:|:.:
  Fly   175 --------RSRDATLSRFKGISMGD 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 32/95 (34%)
ANK repeat 167..193 CDD:293786 7/25 (28%)
ANK 170..276 CDD:238125 35/105 (33%)
ANK repeat 195..226 CDD:293786 12/30 (40%)
ANK repeat 228..263 CDD:293786 12/34 (35%)
IlkNP_525001.2 ANK 28..140 CDD:238125 36/115 (31%)
ANK repeat 33..64 CDD:293786 8/30 (27%)
Ank_2 38..130 CDD:289560 32/95 (34%)
ANK repeat 66..97 CDD:293786 12/30 (40%)
ANK repeat 99..130 CDD:293786 12/34 (35%)
PK_ILK 196..446 CDD:270959
STYKc 204..443 CDD:214568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.